RetrogeneDB ID:
retro_mputfur_547
Organism:
Location:
GL896919.1:1907566-1908386 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.96 %
Coverage:
63.13 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
ENO1
Parental gene aliases:
No gene alias available
Parental gene description:
enolase 1, (alpha) [Source:HGNC Symbol;Acc:3350]

Genomic region (view in browser)





>retro_mputfur_547
GCTGACAATGACATGGCCAAACAGGAGTACACAATCCTCCCATTTGGTACAGCAAACCTC
AAGAAAGTCATGTGCATTGGAGTGGAGCTTCACCACAACCTGAAGAATATCATCAAGAAA
AAATATGGGAAAGATGCCACCAACATGGAGGATGGAAGTGTGTTGACTACTAACATCCTA
AAGAATAAAAAAGCAGCTCTGAAGAATGAGACCAAGATAACCACTTACACCCATAAAGTT
GTCATTGGCATGGACATGACTGCCTTGGAGTTTTTCCAGGCAGGGAAAAGTGTGATCTGG
GCTTCAGATTGTCTGATCACTCAAGTAGGTATATCACATCTGACAAACTGACTGACCTGT
ACAAATTCTTCACCAAAACTAACCAGTGGTGTCTATGGAACATCTCTTTAACCAAGGTGA
CTTGGAATCTCAAAAATAATTCACAGCCAGGACAAGAATTTAGGTGGTAGATAATGGTCT
CAACAGTTATCAACTCAAAACAGATTTCCAAGATTTCCTAAGTGAGAAATCTTATAACTT
CCTCCTGCTTAAAATGAACCAAATTGGCTCTGAGACCAAGTCTTTTCAGGCATGCAAGTT
GGTCTAGTCCAATGCATGGGACTTGATGATGTCTCATCCCTCTAGGGAGACCAAAGACAC
ATTTGTTGCTGGCCTGGTGTTGGGGTTCTGCTCCAGACAAATCAAAAGTGGTACACCTTG
CTGATCTGAGCACTTCACCAAATATAGCCAGCACCTCAGAAATAAAGAGCCACTGGGCAG
CAAGGTTAAGTTTACTGGCAGGAACTCCAGAGACCCTATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGNKLAMQEFMILPVGAASFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKNAIGKAGYTDKVVIGMDVAASEFF-RSGKY
A.N..A.QE..ILP.G.A.....M.IG.E..HNLKN.IK.KYGKDATN..D......NIL.NK.A...LKN......YT.KVVIGMD..A.EFF.R.GK.
Retrocopy
ADNDMAKQEYTILPFGTANLKKVMCIGVELHHNLKNIIKKKYGKDATNMEDGSVLTTNILKNKKAA--LKNETKITTYTHKVVIGMDMTALEFF\RQGKV


Parental protein
-DLDFKSPDDPSRYITPDELANLYKSFIKDY-PVVSIEDPFDQDDWEAWQKFTASAGIQVVGDDLTVTNPKR-ISKAVSEKSCNCLLLKVNQIGSVTESL
.DL.F...D..SRYIT.D.L..LYK.F.K...PVVS.E..F.Q.D.E....FTA...I.VV...L.....K.......SEKS.N.LLLK.NQIGS.T.S.
Retrocopy
\DLGFRLSDHSSRYITSDKLTDLYKFFTKTN/PVVSMEHLFNQGDLESQK*FTARTRI*VVDNGLNSYQLKTDFQDFLSEKSYNFLLLKMNQIGSETKSF


Parental protein
QACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPL
QACKL..SN.W..M.SH.S.ET.DTF.A.LV.G.C..QIK.G.PC.SE...KY.Q.LR..E.LGSK.KF.GR..R.P.
Retrocopy
QACKLV*SNAWDLMMSHPSRETKDTFVAGLVLGFCSRQIKSGTPC*SEHFTKYSQHLRNKEPLGSKVKFTGRNSRDPM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide