RetrogeneDB ID:
retro_mputfur_548
Organism:
Location:
GL896919.1:6548653-6549185 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.09 %
Coverage:
77.78 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
Psma2
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, alpha type 2 [Source:MGI Symbol;Acc:MGI:104885]

Genomic region (view in browser)





>retro_mputfur_548
AAATCCATTCTTTATGATGAGCAAGGTGTACACAAAGTAGAACCAACTACTGAGCATGTA
GGCTTGGTGTATAGTGGCAGGGGCCCAGATTATAGAGTGCTTGTGCATAGAACACAGAAA
CTAGCTCAGTGATACTATCTTGTTAAGCAAGAACCTATTCTAGCAGCTCAGCTGGTATAG
GAAGTAGTTTCTGTGATGCAAGAATATACTCATTCAGGTGGTATTCATCCATTCGGAGTT
TCTTTACTATTTGTGGTTGGAATGAGGGGCAACTGTATTTATTTCAGTCAGATCCATCTG
GAGTTCACTTTGCCTGGAAGGCCTCAGCAATGAGAAAGAACTATGTGAATGGGAAGGCTT
TCCTCAAGAAAAATAACAAAGACCTGGAACTTGAAGATTCCATTCATATGGCCTTAAAGG
AAAGCTTTGAAGGGCAGATGACAGAAGATAACATAGAAGTTGGAACTGCAGTGAAGCCAG
ATTTAGGAGGCCTACTTCAACTGAAGTTAAGGATTACTAGGCTGTTATTAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLL-ICGWNEGRPYLFQSDP
KSILYDE..VHKVEP.T.H.GLVYSG.GPDYRVLVHR..KLAQ.YYLV.QEPI..AQLV..V.SVMQEYT.SGG..PFGVSLL.ICGWNEG..YLFQSDP
Retrocopy
KSILYDEQGVHKVEPTTEHVGLVYSGRGPDYRVLVHRTQKLAQ*YYLVKQEPILAAQLV*EVVSVMQEYTHSGGIHPFGVSLL/ICGWNEGQLYLFQSDP


Parental protein
SGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGI-CNEAGFRRLTPTEVKDYLAAIA
SG..FAWKA.AM.KNYVNGK.FL.K..N.DLELED.IH.A...LKESFEGQMTEDNIEVG..C.EA.FRR.T.TEVKDY.A.I.
Retrocopy
SGVHFAWKASAMRKNYVNGKAFLKKN-NKDLELEDSIHMA---LKESFEGQMTEDNIEVGT/CSEARFRRPTSTEVKDY*AVIS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide