RetrogeneDB ID:
retro_mputfur_55
Organism:
Location:
GL897496.1:76964-78836 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.69 %
Coverage:
85.08 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
UBQLN1
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquilin 1 [Source:HGNC Symbol;Acc:12508]

Genomic region (view in browser)





>retro_mputfur_55
ATGGCTGAGAACGGCGAGAGTAGCGGCCCCCCGCGCCCCTCCCGCGGCCCTGCTGCGGCC
CAAGGCCCTGCCTCTGCCCCGGCCGAGCCCAAAATCATCAAAGTCACTGTGAAGACCCCC
AAAGAGAAAGAGGAGTTCGCGGTGCCCGAGAATAGCTCAGTCCAGCAGTTTAAGGAAGCG
ATTTCGAAACGCTTCAAATCCCAAACCGATCAGCTAGTGTTGATTTTTGCCGGAAAAATC
TTGAAAGATCAAGATACCCTGATCCAGCATGGCATCCATGATGGACTGACTGTTCATCTT
GTAATTAAAAGCCAGAACCGACCTCAGGGCCAGTCCACACAGCCTAGTAATGCCGCGGGA
ACTAACACTACCTCCGCGTCGACTCCCAGGAGTAACTCCACATCTATTTCCACAAATAGC
AACCCGTTTGGGCTGGGGAGCTTGGGAGGACTTGCAGGCCTTAGCAGCCTGGGCTTGAGC
TCGACCAACTTCTCTGAGCTCCAGAACCAGATGCAGCAGCAGCTCCTGTCCAGCCCTGAG
ATGATGATCCAAATCATGGAAAATCCCTTTGTTCAGAGCATGCTTTCAAACCCCGATCTA
ATGAGGCAGCTCATTATGGCCAATCCACAGATGCAGCAATTGATTCAGAGAAACCCAGAA
ATCAGTCACCTGCTCAACAACCCAGATATAATGAGGCAGACCCTCGAAATTGCCAGGAAT
CCGGCCATGATGCAAGAGATGATGAGAAATCAAGATCTGGCTCTCAGCAATCTTGAAAGC
ATCCCAGGTGGCTACAATGCCCTACGACGCATGTACACTGACATTCAAGAACCCATGCTG
AATGCTGCACAAGAGCAGTTTGGGGGTAATCCATTTGCTTCAGTGGGGAGCAATTCCACC
TCCGGGGAAGGTACACAGCCTTCCCGCACAGAAAATCGGGATCCACTACCCAATCCATGG
GCACCACCACAGGCTACCCAGAGTTCTGCAACCACCAGCACAACCACAAGCAGTGGCAGT
GGGTCTGGCAGTAGCTCCAGCAGTGCTACCGGGAACACTGTGGCTGCAGCGAACTATGTC
GCCAGCATCTTCAGTACCCCAGGAATGCAGAGCTTGCTGCAACAGATAACTGAAAATCCC
CAACTGATCCAGAATATGCTGTCTGCACCCTACATGAGAAGCATGATGCAGTCACTGAGC
CAGAATCCAGATTTGGCTGCACAGATGATGCTGAATAGCCCCGTGTTTACTGCAAATCCT
CAGTTGCAGGAGCAGATGCGTCCACAGCTCCCAGCTTTCCTGCAGCAGATGCAGAATCCA
GACACACTGTCAGCCATGTCAAACCCAAGAGCAATGCAGGCTTTAATGCAGATCCAGCAG
GGGCTACAGACATTAGCCACTGAAGCTCCTGGCCTTATTCCAAGCTTCACTCCAGGTGTG
GGGGTAGGGGTGCTGGGAACCGCTATAGGCCCTGTAGGCCCAGTCACACCCATAGGCCCC
ATAGGCCCCATAGTCCCGTTCACTCCCATAGGCCCCATTGGGCCCATAGGACCCACTGGC
CCTGCAGGCCCTGGCTCCACTGGCTCTGGTGGTCCCCCTGGGCCCACTGTTTCTAGTTCT
ACACCCAGTGAAACCACTAGCCCAACATCAGAATCTGGACCCAACCAGCAGTTCATTCAG
CAAATGGTGCAGGCTCTGGCTGGGGCAAGTCCTCCACAGCTGCCGAATCCAGAAGTCAGA
TTTCAGCAACAACTGGAACAGCTCAACGCAATGGGGTTCTTAAACCGTGAGGCAAACTTG
CAGGCTCTAATAGCAACAGGAGGCGACATCAATGCTGCCATTGAGAGGCTGCTGGGCTCC
CAGCCATCGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAESGESGGPPSSQDSAAAAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGL
MAE.GES.GPP......AAA.G.....A.A.AEPKI.KVTVKTPKEKEEFAVPENSSVQQFKE.ISKRFKS.TDQLVLIFAGKILKDQDTL.QHGIHDGL
Retrocopy
MAENGESSGPPRPSRGPAAAQGP----ASAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGL


Parental protein
TVHLVIKTQNRPQDHSAQQTNTSGSNVTTSSAPSTNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLMSNPEMMVQIMENPFVQSMLS
TVHLVIK.QNRPQ..S.Q..N..G.N.T..S.P..NSTS.S..SNPFGLG.LGGLAGLSSLGL..TNFSELQ.QMQ.QL.S.PEMM.QIMENPFVQSMLS
Retrocopy
TVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTSISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQNQMQQQLLSSPEMMIQIMENPFVQSMLS


Parental protein
NPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
NPDLMRQLIMANPQMQQLIQRNPEISH.LNNPDIMRQTLE.ARNPAMMQEMMRNQD.ALSNLESIPGGYNALRRMYTDIQEPML.AAQEQFGGNPFAS..
Retrocopy
NPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVG


Parental protein
SNTSSGEGSQPSRTENRDPLPNPWAPQASQSSSASSGTTSTVGGTGANAASGTSGQSSSAPNLGPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYM
SN..SGEG.QPSRTENRDPLPNPWAP.....SSA...TTST....G....S..S............V.AS.F.TPGMQSLLQQITENPQL.QNMLSAPYM
Retrocopy
SNSTSGEGTQPSRTENRDPLPNPWAPPQATQSSA---TTSTTTSSGSGSGSSSSSATGNTVAAANYV-ASIFSTPGMQSLLQQITENPQLIQNMLSAPYM


Parental protein
RSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGS
RSMMQSLSQNPDLAAQMMLN.P.F..NPQLQEQMR.QLP.FLQQMQNPDTLSAMSNPRAMQAL.QIQQGLQTLATEAPGLIP.FTPG.G..G..G...G.
Retrocopy
RSMMQSLSQNPDLAAQMMLNSPVFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVG-VGVLGTAIGP


Parental protein
NG
.G
Retrocopy
VG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide