RetrogeneDB ID:
retro_mputfur_550
Organism:
Location:
GL896919.1:13295164-13295844 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.53 %
Coverage:
60.8 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
ADIPOR1
Parental gene aliases:
No gene alias available
Parental gene description:
adiponectin receptor 1 [Source:HGNC Symbol;Acc:24040]

Genomic region (view in browser)





>retro_mputfur_550
TTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAGTGTGTACTTCAAGGCCCCTCTA
AGGAGAAGGCGATTTTGGGGATGTTCTTTTTGGGTGCAGTGCTCTGCTTCATCTTCTCCT
AGCTCTCTCCCACCATCTGTTGTCATTCAGAAAAAGCCTCTCTGATTTTTTTTCCAAACT
GTATTATTCAGGGATTGCTCTGCTGATGATGGGGAGCTTTGTCTCCTGGCTCTATGACTC
CTTCTCCTGCTCCCCACAGCTGTGGCTCATTCGTCTCTCCATCGTCTGTGTGCTGGACGT
TTCTGCCATCACTGTAGCACAGTGGGACTGGTTTGCTGCTCCTAGACACCGGCAGACAAG
GGCAGGAGGGTTCCTGGGACTTGGCTTGAGCAGTGTTGAGCCCACCATACACTTCACTAT
CGCTGAGGGCTTTGTCAAGGCCAGTGGGCCAGTTGGGCTGGTTCTTCTTTATGGCTGTGA
TGTACATCACCGGAGCTGGCCTTTATGCTGCTTGAATTCCTGACCATATTCTTGCCTAGA
AAATTAGACCTAGGATTCCATTCTCATCAGATTTCCCCTGTCCCTTGGTAGCCACAGCCT
TTGTCCACTTCTACGGGGTCTCCAACCTTTAAGAATTCCATTAGGGCCAAGAGGGTGGCT
GTAGAGATGCCTCCCTTCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FLFLGILTMLRPNMYFMAPLQ-EKVV-FG--MFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVC
FLFLGILTMLRP..YF.APL..EK...FG...F...A.L.L....L.H.........S....KL.YSGIALL.MGSFV.WLY.SF.CSPQ..LI.LSIVC
Retrocopy
FLFLGILTMLRPSVYFKAPLR/EKAI/FGDVLFGCSALLHLLLA-LSHHLLSFRKSLSXXXXKLYYSGIALLMMGSFVSWLYDSFSCSPQLWLIRLSIVC


Parental protein
VLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMG-WFFLMAVMYITGAGLYAARIPER-FFPGKFDIWFQSHQI-F
VL..SAI.VAQWD.FA.P.HRQTRAG.FLGLGLS.V.PT.HFTIAEGFVKA...G..G.WFF.MAVMYITGAGLYAA.IP...F.P.K.D..F.SHQI.F
Retrocopy
VLDVSAITVAQWDWFAAPRHRQTRAGGFLGLGLSSVEPTIHFTIAEGFVKAS--GPVG\WFFFMAVMYITGAGLYAA*IPDH\FLPRKLDLGFHSHQI/F


Parental protein
HVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL
....VA.AFVHFYGVSNL.EF..G.EGGC.D.SLL
Retrocopy
PCPLVATAFVHFYGVSNL*EFH*GQEGGCRDASLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide