RetrogeneDB ID:
retro_mputfur_551
Organism:
Location:
GL896919.1:1090571-1091445 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.34 %
Coverage:
54.85 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
SNW1
Parental gene aliases:
No gene alias available
Parental gene description:
SNW domain containing 1 [Source:HGNC Symbol;Acc:16696]

Genomic region (view in browser)





>retro_mputfur_551
CAAGAGTGGAAGATTCCTCCTTGTATTTCAAACTGGAAAAATGGGAAGTGCTATACAATT
CCACTAGACAAACATCTGCTGCTAATAGAAGAGGACAGCAAACAATGCACATCAATTGAG
AACTTTGCTAAGCAGGCTGAAGCCCTCTATTTTGCTTATTGGAAAGCTTGTGAAGGTGTA
GAAATATGGGCTCAAGTAGAGAGAAATATGGCTCAACAAGAAAATGAGAAACATGAACAG
AAAATTAGAAAAATGGCCCAGAAAGCCTGGTAGAGAAGAGTTGGGATCAAAACCCATGTG
GAAAAAGAGAATGGAGAGGCACTTAAGAGGGATGAAATCTGGCATGACAGATGAAAAGAG
AGACAGTACAATGGGGGAATCTTTCCAGGCAGCTCCTGATAAGAGGTTAAAACTACAGAG
AAATGAAAATCAAAATATCAGTGAAGTCATTGCTCCCGGTATGCCCAATCCTCAGAAATT
CTGTGAAGTCCAGTATGACCAAAGGGTCTTCAACCAACCCAGGGGTGTGGAGAGTGATTT
TGCAGGTAGAGAAGATGAAATTTACAATGTTTATGATTAAGCCTGGAGAGGTGGTAAAGA
TATGGCCCAGAATATTTTCATGCCTGGGAAAAATTTGGACAAGGACATGCATGATGATGA
CCTAGGAGCCAGAATAAAGACCAACACTTTGGTTCCTGATAACTTTTCTGGTTCAGATCG
CAGGCAAAAAGGCTGAGAAGGATCAGTTCAGTTTGAGGAAGATCATTTGGATTTGGACAA
GTTTTTGAAAGTAGCCAAAGAGCACAGTGGTTCCAAAAGACTCTTAGATAACAGCTGCCG
CAGTGAACATGAGGGTAAGAAGAAGAGGAAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QEWKIPPCISNWKNAKGYTIPLDKRL-AADGRGLQTVHIN-ENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKT
QEWKIPPCISNWKN.K.YTIPLDK.L.AA..RG.QT.HIN.ENFAK.AEALY.A..KA.E.VE..AQVER.MAQ................A..RR.GIKT
Retrocopy
QEWKIPPCISNWKNGKCYTIPLDKHL/AANRRGQQTMHIN\ENFAKQAEALYFAYWKACEGVEIWAQVERNMAQXXXXXXXXXXXXXXXXAW*RRVGIKT


Parental protein
HVEKEDGEARERDEIRHDRRKERQHDRNLS-RAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRG
HVEKE.GEA..RDEI.HDR.KERQ........AAPDKR.KLQRNEN..ISEVIA.G.PNP....EVQYDQR.FNQ..G..S.FAG.EDEIYNVYD.AWRG
Retrocopy
HVEKENGEALKRDEIWHDR*KERQYNGGIF\QAAPDKRLKLQRNENQNISEVIAPGMPNPQKFCEVQYDQRVFNQPRGVESDFAGREDEIYNVYD*AWRG


Parental protein
GKDMAQNIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
GKDMAQNI..P.KNLDKDM..DDL.ARIKTN..VPD..FSGSDRRQ.G.EG.VQFEED...LDKFL..AK.H.GSKR..D.S.....EHEGKK.RK.
Retrocopy
GKDMAQNIFMPGKNLDKDMHDDDLGARIKTNTLVPD-NFSGSDRRQKG*EGSVQFEEDHLDLDKFLKVAKEHSGSKRLLDNS--CRSEHEGKKKRKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide