RetrogeneDB ID:
retro_mputfur_553
Organism:
Location:
GL896919.1:8058385-8058990 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.98 %
Coverage:
66.13 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
NANOG
Parental gene aliases:
No gene alias available
Parental gene description:
Nanog homeobox [Source:HGNC Symbol;Acc:20857]

Genomic region (view in browser)





>retro_mputfur_553
GTAACAGCAGATCCAGCTCTGCCTGGTCCTGGAGAACCCAGTTCTTGGGATTCTTCTCCA
ATGCCTGAGATTTATCAGCCTGAAGAAAATTATGTGTCCCTGCAAATGTCATCTGCTGAG
ACACCCCACATGAAGAACATTTCTCTTCTTCCTTCCTCCATGAATCTGCTTATTCAGGAC
AGCCCCAAGTGCCCCACCAATCCCAGGGTGAAACTACCACGTACTTCTGCAGAGTAGAGA
ACAGTGAGGAAGGAAGATATGGCCCAGGGCAAGAAATGAAGATTGGGACCATGTTCTCTC
CCCAACCCAACTCTATGTCCTCAATGATCAATTTCAGAGACAAAAATACCTGAGTCTCCA
GCAGATGCAAGACCTTTCCAACATTCTGAACCTTAGCTATAAACAGGTGAAGACCTAGTT
CCAGAACCAGAAAATGAAATGTAAAAGGTGGCAGGAAAAACCACTGGCCAAAGGAGAGCA
AGAGTATGACTCAGAACAGCACAGTAACCACTGAATACCCAGGCTTCTATTCCTACAACC
AGGGATACCTGATGAGCACTTCCAGAAACCTTCCAGTATGGAGCAACCAGACCTGGAATA
ATCCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSADPAPPQCRSGPRPPGSRDSSPMPEVCRHEENYAFLQMSSAETPHAETVSPLPSSVDLLVQDSPDSSTSPKVKLPPTSAEERTGRREDTAQGKKQKIR
..ADPA.P....GP..P.S.DSSPMPE....EENY..LQMSSAETPH....S.LPSS..LL.QDSP...T.P.VKLP.TSAE.RT.R.ED.AQGKK....
Retrocopy
VTADPALP----GPGEPSSWDSSPMPEIYQPEENYVSLQMSSAETPHMKNISLLPSSMNLLIQDSPKCPTNPRVKLPRTSAE*RTVRKEDMAQGKK*RLG


Parental protein
T-VFSQTQLYVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQ-KNHWPKESKSVTQNSTAATEYPAFYSYHQGHLMNTSANLPIWS
..V.S.TQLYVLND.FQRQKYLSLQQMQ.LSNILNLSYKQVKT.FQNQ.MKCKRWQ.KNHWPKESKS.TQNST..TEYP.FYSY.QG.LM.TS.NLP.WS
Retrocopy
P\VLSPTQLYVLNDQFQRQKYLSLQQMQDLSNILNLSYKQVKT*FQNQKMKCKRWQ\KNHWPKESKSMTQNSTVTTEYPGFYSYNQGYLMSTSRNLPVWS


Parental protein
SQTWNNP
.QTWNNP
Retrocopy
NQTWNNP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide