RetrogeneDB ID:
retro_mputfur_557
Organism:
Location:
GL896919.1:16637048-16637412 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.2 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_557
CTAGAGGCATTCTGAATGGTACAGTGTTTGACATACTGTCATATGCCATCCTACAAAACA
GCCGCTAACAAAACTAGGCTGTCGCAAACCCCTGATAATAGAATTGTTTACTTTTATATC
AAGAGGTTTGAGAAAGCACCAAAATCTGTACGTGACATATTTCCAGGCTGACTTCAATGG
GTTCATGCTGTAAGAGCTAAAGTTTTTGTGAACATGTCTAAAATGAAAAAAACTCATCGG
TAGGGCCTATGGTACTTCCATGTGTGCTTAATTTGCCCCTGACCAGAACAAGTGTGTTTT
TCCTCACTGAGGAGCAGAAAATTGTGAAAGTGGTAAAGGCACAGCACAGAGTTTAAAAGC
TAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKAFRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKH-VSRAYGGSMCAKCVRDRIKRA
..AF.MVQ.LTY....SY.TA.NKTRLS.TP.NRIVY.Y.K...KAPKS.....PG.L..V.AVR.KV....SK.KK....RAYG.SMCA....D..K..
Retrocopy
LEAF*MVQCLTYCHMPSYKTAANKTRLSQTPDNRIVYFYIKRFEKAPKSVRDIFPG*LQWVHAVRAKVFVNMSKMKKT\IGRAYGTSMCA*FAPDQNKCV


Parental protein
-FLIEEQKIVVKVLKAQ-AQSQKAK
.FL.EEQKI.VKV.KAQ.AQS.KAK
Retrocopy
\FLTEEQKI-VKVVKAQ/AQSLKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide