RetrogeneDB ID:
retro_mputfur_558
Organism:
Location:
GL896920.1:319076-320060 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.27 %
Coverage:
88.06 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TRAM1
Parental gene aliases:
No gene alias available
Parental gene description:
translocation associated membrane protein 1 [Source:HGNC Symbol;Acc:20568]

Genomic region (view in browser)





>retro_mputfur_558
ACGGCCGAAGCGTCTATCGTTTTTATTACCCTTCAGCACAGTGTTCCCTTCCCTGCGGCA
GCAGAGCGAGCCACAGAATCAAAGTTCCTTTACTATTATGGCATCAAAGATTTGGCCACG
GTTTTCTTCTACATGCTGGTGGCAATCATCATTCACGCCACAATTCAGGAGTATGTGTTG
GATAAAATTAACAGGCGAATGCAGTTCCCCAAAGCGAAACAAAGCAAATTTAATGAATCT
GGCCAGTTTAGTGTGTTCTACCTGGTGTCTTGTATTTGGGGCACATTCATTCTCATTTCT
GAAAACTGTCTGTCAGACCCAACTCTCTTATGGAGGGCTCATCCCCATAATATGATGACC
TTCCAAATGAAGTTTTTCTACATATCACAGTTGGCTTACTGGTTTCATGCCTTTCCTGAA
CTCTATTTCCAGAGAATCAAAAAGCAAGACATCCCTCGTCAACTCGTCTACATTGGCCTT
CACCTCTTTCACATCGCCGGAGCTTACCTCTTGTACTTGAATCATCTGGGACTTGTTCTT
TTGATGATGCACTACTTTGTTGAGTTACTTTCCCACATGTGTGACCTGTGTTATTTTAGT
GATGAAAAGTACCAGAAAGAGTTTTCTCTGTGGGCAATTGTGTTTATTTTGGGTCGACTT
GTGACTCTCATTGTGTCTGTGGTGACTGTTGGCTTTCACCTGGCCGGAGGGCAGAATCGG
AATCCAGATGCTCTTGGTGGAAATGTAAATGTGTTGGCAGCTAAAATCGCTGTTCTTTCA
TCCAGTTGCACCATCCAAGCGTACATAACATGGAATTTATTTAATGTCCAGCTTCAGAGG
TGGATGGAGGAAGACACTACTCTTCAGGCCCCCGTTGTGAAGAAGAAACGGACTAAAGGG
AGGTCTTCTAGAAAAGGAACAGAAAATGGTGTAGCAACTTCAAATAGAGTAGACTCTCCC
CATAAAAGGAAAGAGAAATCTTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TAKASIIFVTLQYNVTLPATEEQATESTSLYYYGIKDLATVFFYMLVAIIIHAIIQEYVLDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGTFILIS
TA.ASI.F.TLQ..V..PA..E.ATES..LYYYGIKDLATVFFYMLVAIIIHA.IQEYVLDKINRRM.F.K.K.SKFNESGQ.S.FYL.SCIWGTFILIS
Retrocopy
TAEASIVFITLQHSVPFPAAAERATESKFLYYYGIKDLATVFFYMLVAIIIHATIQEYVLDKINRRMQFPKAKQSKFNESGQFSVFYLVSCIWGTFILIS


Parental protein
ENYISDPTILWRAYPHNLMTFQMKFFYIAQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFS
EN..SDPT.LWRA.PHN.MTFQMKFFYI.QLAYWFHAFPELYFQ..KK.DIPRQLVYIGL.LFHIAGAYLL.LNHLGLVLL..HYFVE.L.H...L.YFS
Retrocopy
ENCLSDPTLLWRAHPHNMMTFQMKFFYISQLAYWFHAFPELYFQRIKKQDIPRQLVYIGLHLFHIAGAYLLYLNHLGLVLLMMHYFVELLSHMCDLCYFS


Parental protein
DEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSAGNFNVLAVRIAVLASICITQAFMMWKFINFQLRRW-REHSAFQAPAVKKKPTVT
DEKYQK.FSLWA..F.LGRL.TLI.SV.TVGF.LA...N...D...GN.NVLA..IAVL.S.C..QA...W...N.QL.RW..E....QAP.VKKK...T
Retrocopy
DEKYQKEFSLWAIVFILGRLVTLIVSVVTVGFHLAGGQNRNPDALGGNVNVLAAKIAVLSSSCTIQAYITWNLFNVQLQRWMEEDTTLQAPVVKKKR--T


Parental protein
KGRSSRKGTENGVNGTVTSNGADSPRNRKEKSS
KGRSSRKGTENGV....TSN..DSP..RKEKSS
Retrocopy
KGRSSRKGTENGV---ATSNRVDSPHKRKEKSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide