RetrogeneDB ID:
retro_mputfur_560
Organism:
Location:
GL896920.1:3064480-3064905 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.9 %
Coverage:
51.61 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_560
CTTGTAGGAGTTACTGATCCTGGGGCTCACCGGTAGCCTATCACAGAGGTGTGTTGTGTT
AATCTGCCTACTGCTGCTCTCCGTAACACAGACTTTGCTCTGTACTATGTGGACATTACC
ATTCTTTGCAACAAGGGAATTCATTCTGCAAATCTGATATGGTAAATGATGGCCCAGGGA
GCTCTGCGCATGCATGGCAGGATCTCCCTTGAACTTCCATGGGAGGTAATGCATGATCTC
TACTTACAGATATCCTGGAGAGAGTAAAGAGAACAGGCTGCTGCTGAAAAGCCCATGACC
AAGAAGGAATTTCAGGGTGAGTGGACTGCTCCAGCTCCCTAAATTTCCTGCTAACTCAAC
CTGAAATCTCAGGCTGGTCTAAAGGTACAGAGGTTCCCTTTGTGCCCATCCAGTAGTTTC
TTACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEK
L..VTDP.A...P.TE...VNLPT.AL.NTD..L.YVDI.I.CN.KG.HS..L.W.M.A...LRM.G.IS.E.PWEVM.DLY......E......AAAEK
Retrocopy
LVGVTDPGAHR*PITEVCCVNLPTAALRNTDFALYYVDITILCN-KGIHSANLIW*MMAQGALRMHGRISLELPWEVMHDLYLQISWRE*REQ--AAAEK


Parental protein
AVTKEEFQGEWTAPA-PEFTA-TQPEVADWSEGVQVPSVPIQQFPT
..TK.EFQGEWTAPA.P.F.A.TQPE...WS.G..VP.VPIQ.F.T
Retrocopy
PMTKKEFQGEWTAPA\PKFPA\TQPEISGWSKGTEVPFVPIQ*FLT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide