RetrogeneDB ID:
retro_mputfur_569
Organism:
Location:
GL896921.1:10913633-10915247 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.93 %
Coverage:
99.08 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
GALNT12
Parental gene aliases:
No gene alias available
Parental gene description:
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 (GalNAc-T12) [Source:HGNC Symbol;Acc:19877]

Genomic region (view in browser)





>retro_mputfur_569
TCCCGGGAGCAGGGGCCCAAACAGCTTTCAGACCCCTGGGAAAAGGCAGAGGATTTGTCT
CGACCGCTCTACAAGAAGCCGCCTGCAGATTCCCATGCGCTTGGGGAGTGGGGCAAAGCC
AGCAAGCTCCAGCTCAGCGAGGGTGAACTGAAGCAGCAAGAAGAACTTATTGAGAGATAT
GCCATTAATATTTATCTCAGTGACAGGATTTCCCTCCATCGCCACATAGAGGACAAGAGA
ATGTATGAGTGTAAATCCAAGAAGTTTAATTATAGGAGACTTCCCACCACCTCTGTTATC
ATTGCTTTCTATAATGAAGCCTGGTCGACTTTGCTGCGCACCGTCCACAGTGTTTTAGAA
ACTTCTCCTGCAGTCCTTTTGAAGGAGATCATCTTAGTGGATGACTTGAGTGACAGAGTT
TATTTGAAGACACAGCTTGAAACTTACATCAGCAATCTTGATAGAGTCCGCCTGATTAGA
ACAAATAAGCGGGAGGGGCTGGTTAGAGCCCGCCTGATTGGGGCCACTTTTGCCACTGGG
GATGTCCTCACTTTCCTGGATTGTCACTGTGAGTGTAATTCTGGTTGGTTAGAACCACTT
CTGGAAAGAATTAGTTACGATGAGACGGCAGTTGTTTGCCCTGTTATAGATACCATTGAT
TGGAATACTTTTGAATTCTATATGCAGACTGGGGAGCCCATGATTGGTGGATTTGACTGG
CGCTTAACCTTCCAGTGGCATTCTGTCCCCAAGCACGAAAGGGACAGACGGAAATCGAGA
ATTGACCCAATCAGATCGCCCACCATGGCTGGAGGACTGTTTGCCGTCAGCAAGAAATAT
TTTCAGTACCTTGGAACATATGACACTGGAATGGAAGTGTGGGGAGGTGAAAACCTTGAG
CTGTCTTTTAGGGTCTGGCAGTGTGGAGGTAAATTGGAGATCCACCCGTGTTCCCACGTG
GGGCATGTATTCCCCAAGCGGGCGCCCTATGCTCGGCCCAATTTCCTACAGAATACTGCT
CGGGCAGCAGAAGTGTGGATGGACGAGTACAAAGAGCATTTCTACAATCGAAACCCTCCA
GCAAGGAAGGAAGCTTATGGTGATATTTCTGAAAGAAAATTACTCCGTGAACGGCTGAAG
TGCCAGAGTTTTGACTGGTATTTGAAAAACGTGTTTTCTAATTTACACGTCCCAGAGGAT
AGGCCAGGTTGGCATGGAGCTGTCCGCAGTATGGGCATCTCTTCTGAATGTTTAGATTAT
AATTCTCCTGACAACAACCCCACAGGCGCTAACCTTTCCCTGTTTGGATGCCATGGTCAA
GGAGGCAATCAATTCTTTGAATATACTTCAAACAAAGAAATCAGGTTTAACTCTGTGACA
GAGTTATGTGCAGAGGTTCCTGAGCAAAAAAAATATGTAGGAATGCAAAATTGTCCAAAA
GATGGGTTCCCTATCCCCGCAAACATTATTTGGCATTTTAAGGAAGATGGAACCATTTTT
CATCCACACTCGGGGCTATGTCTTAGTGCTTTTCGGACACCTGAGGGTCGACCTAATGTT
CAAATGAGAACTTGTGATGCTCTAGATAAAAATCAAATCTGGAAGTTTGAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NRKAGGRVSASPRECPVKISHPPRLGGRAPXPDDALGARGEAVRLQLQGEELRLQEESVRLHQINIYLSDRISLHRRLPERWNPLCKEKKYDYDHLPTTS
.R..G......P.E.....S.P..L....P....ALG..G.A..LQL...EL..QEE......INIYLSDRISLHR.........CK.KK..Y..LPTTS
Retrocopy
SREQGPKQLSDPWEKAEDLSRP--LYKKPPADSHALGEWGKASKLQLSEGELKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSKKFNYRRLPTTS


Parental protein
VIIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDREHLKERLANELSSLPKVRLIRANKREGLVRARLLGASAAKGEVLTFLDCHCECHEGWLE
VIIAFYNEAWSTLLRTV.SVLETSP..LL.E.ILVDD.SDR..LK..L....S.L..VRLIR.NKREGLVRARL.GA..A.G.VLTFLDCHCEC..GWLE
Retrocopy
VIIAFYNEAWSTLLRTVHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETYISNLDRVRLIRTNKREGLVRARLIGATFATGDVLTFLDCHCECNSGWLE


Parental protein
PLLQRIGEEESAVVCPVIDVIDWNTFEYLGNPGEPQIGGFDWRLVFTWHVVPERERVRMRSPIDVIRSPTMAGGLFAVSKKYFEYLGSYDTGMEVWGGEN
PLL.RI...E.AVVCPVID.IDWNTFE.....GEP.IGGFDWRL.F.WH.VP..ER.R..S.ID.IRSPTMAGGLFAVSKKYF.YLG.YDTGMEVWGGEN
Retrocopy
PLLERISYDETAVVCPVIDTIDWNTFEFYMQTGEPMIGGFDWRLTFQWHSVPKHERDRRKSRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGEN


Parental protein
LEFSFRIWQCGGTLETHPCSHVGHVFPKQAPYSRNKALANCVRAAEVWMDEFKELYYHRNPHARLEPFGDVTERKQLRAKLQCKDFRWFLENVYPELHVP
LE.SFR.WQCGG.LE.HPCSHVGHVFPK.APY.R...L.N..RAAEVWMDE.KE..Y.RNP.AR.E..GD..ERK.LR..L.C..F.W.L.NV...LHVP
Retrocopy
LELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRERLKCQSFDWYLKNVFSNLHVP


Parental protein
EDRPGFFGMLQNKGLKDYCFDYNPPNENQIMGHQVLLYLCHGMGQNQFFEYTSQKEIRYNTHQPEACIAVEAGTDILTMHLCQD---TVPENQKFILQED
EDRPG..G.....G....C.DYN.P..N...G....L..CHG.G.NQFFEYTS.KEIR.N....E.C..V........M..C.......P.N......ED
Retrocopy
EDRPGWHGAVRSMGISSECLDYNSPDNNP-TGANLSLFGCHGQGGNQFFEYTSNKEIRFNS-VTELCAEVPEXXXYVGMQNCPKDGFPIPANIIWHFKED


Parental protein
GSLFHTQSNKCVQAERKPFSDSFVPLLRDCTDSEHQKWLFKE
G..FH..S..C..A.R.P.....V...........Q.W.F..
Retrocopy
GTIFHPHSGLCLSAFRTPEGRPNVQMRTCDALDKNQIWKFEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide