RetrogeneDB ID:
retro_mputfur_571
Organism:
Location:
GL896921.1:12960506-12961278 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.5 %
Coverage:
89.93 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_571
ATGGCAGGTGAAAAGGCTGAGAAACTGGATGTTAAGGAAAAGAAACCTGAAACCAAGAAG
GTTTATCCTGGTGCCAAAGTGAAGAAGGGTAACATCAAGGCTAGAATGCGAAAGAAGAGG
AAGCCCCACTACAGTTGAAACCCTGTCCTAGCTAGAGAAATTGGCAGCTATTTCTGGTAG
GCTCTGTATTCCAGAAAGGCTACATACAAGAGGGAGTATTCAGTAGCTAAATCCAGCTTT
GAGAAGAAAAGGATAAGGTTCTTGCTACTGTCATAAAACCAGTTGGTGGTGACAAGAATG
ATGGTACCCAAGCGGTTAAACTTCGCAAAATGCCTAGGTATTACCTGACTGAAGATGCGC
CTTGAAAGCTGCTAAGCCACAGTAAAAAATCTTTCAAGCAGCATGAGAGAAAACTGTGAG
CAGGTGTCACTCCTAGGATCATTATGATCACCCTCACTGGGTGCCACAGAAGCAAGAAGG
GGTTTCCCTGAAGCAACTGAGAAGTGGTTTGTTACTTTTGACTGGACCTCTGGCCCCCAA
TTAAGGTCCTCTGTGTAGAATACAACAGAAATTTGTCATTGCCACCTCCACCAAAATTGA
TAGCAGCAGTGTGAAAATCCCAAAACATCTGACTGATGCTTGCTTCAAGAAGCAGCAGCT
GCATAAACCTGGACACCAGGAAGGCGGGATCTTTGACTCAGAGAAAGAGAAATACAAGAT
TACAGAGCAGTGCAAGGTTGATCAGAAAGCTGTGAACTGGCAGATTCGGCCG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAGEKAEKPDTKEKKPEAKKTDGGGKAKKGNKKAKTPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSRVEKKK-KEKVLATVTKPVGGD
MAGEKAEK.D.KEKKPE.KK...G.K.KKGN.KA...KK.KPH.S.NPVL.R.IG.Y...A.YSRKA.YKR.YS.AKS..E.KK.K.KVLATV.KPVGGD
Retrocopy
MAGEKAEKLDVKEKKPETKKVYPGAKVKKGNIKARMRKKRKPHYS*NPVLAREIGSYFW*ALYSRKATYKREYSVAKSSFE-KK/KDKVLATVIKPVGGD


Parental protein
KNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRV-VFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATS
KN.GT..VKLRKMPRYY.TED.P.KLLSH.KK.F.QH.RKL.A..TP..I.I.LTG.HR.K...V.LKQL.SGLLL.TGPL..N..PL.R..QKFVIATS
Retrocopy
KNDGTQAVKLRKMPRYYLTEDAP*KLLSHSKKSFKQHERKL*AGVTPRIIMITLTGCHRSKKG/VSLKQLRSGLLLLTGPLAPN*GPLCRIQQKFVIATS


Parental protein
TKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKVDQKAVDSQILP
TKID.S.VKIPKHLTDA.FKK..L.KP.HQEG.IFD.EKEKY.ITEQ.KVDQKAV..QI.P
Retrocopy
TKIDSSSVKIPKHLTDACFKKQQLHKPGHQEGGIFDSEKEKYKITEQCKVDQKAVNWQIRP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide