RetrogeneDB ID:
retro_mputfur_572
Organism:
Location:
GL896921.1:14247948-14249183 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.99 %
Coverage:
62.71 %
Frameshifts:
8
Stop codons:
8


Parental gene:
Parental gene symbol:
EWSR1
Parental gene aliases:
No gene alias available
Parental gene description:
EWS RNA-binding protein 1 [Source:HGNC Symbol;Acc:3508]

Genomic region (view in browser)





>retro_mputfur_572
ATGGTGTCTACAGATTACATCACTCACAGTCAAGCTGCAGCCCAATAGGGCTACAGTGCA
TACACCACTCAGCCCACTCAAAGATATGCACAGACCACCCAGGCATATAGGCAGCAAAGT
TATGGAACCTATGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGATCACTGCAACTG
ACAGGCAGACCACCTATGCAACTTTTTATGGAACAGCTTCCCACTAGTTATACTACTCCA
TCTGCCCACCTCTACCTGCCCCATGTGTAAAGTCATTTTGTCCAAGTGGACAGCAATGGT
GTAAATGATACCACCACTGCTATGGTCACGAACACCCAGGCCTCCTATACAGCTCAGTCT
GCATATGGCACTTGACCTACTTATCCAGTCTATGGGCAGCAGCCAATAGCCACTGAACCT
GCAAGACCACAGGATGGTAACAAGTCTGCTGAGACTAGTCAACCTCATTCTAGCACAGGA
GGTTACAACTAGCCCAACCTAGGATATGGACAGAATAACTATAGTTATCCCCAGGTACCT
GGGAGCTACCCCATGCAGCCAGTCACAGCACCATCATCTTCTCCTACCAGCTATTCCTCT
GCACAGCCAACTAGGTATGATCAAAACCGTTACTCTCAGCGGAACACCTATGCGTAGCCC
ACCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGTGGCTATGGGAAGCAGCCACCC
ACCAGTTATCCCCACCAAACTGGATCCTACAGCCAGACTTTAAGTCAATAGAGCCAACAG
AGCAGCAGCTATAGGCAGCAGAGTTCATTCTGACAGGACCACCCCAGTAGCATGGATGTT
TACAGGCAGGATTCTGGAGGATTTTCCAGATAGGAGAGAATGGAACATGAGTGAGCCTGA
TAACTGGGGCAGGGAAGAGGGGTATTTGATAGGTGGAAGCATGAACAGAGGGGGGTAGGG
AGAAGGATGCAGTGGAATGGGCTCTGGAGAGCAAGGTGGCTTCAATAAGCCTGGTGAACC
CACGGTCAAAGGACCAGATCTTGATCTAGGCCCATCTGTAGATCCAGATGAAGACTCTGA
CAATGTGCAATTTATGTGCAAAGCTTAAATGACAATGTGATTCCAAATGATCTAGCAGAC
TTCATTAAGCAGTGTGGAGTTGTTAAGAGAACAAGAGAACTGGACAATCCATGACCCACA
GCTACTTGGGCAAGGAAACAGAAGAGCCCAAAGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQQAYGQQSYGTYG-QPTDVSYTQAQTTATYGQTAYATSYG-QPPAGYTTPTA----PQAYSQPVQGY
M.STDY.T.SQAAAQ.GYSAYT.QPTQ.YAQTTQ.AY.QQSYGTY..QPTDVSYTQAQ.TAT..QT.YAT.YG.Q.P..YTTP.A....P...S..VQ..
Retrocopy
MVSTDYITHSQAAAQ*GYSAYTTQPTQRYAQTTQ-AYRQQSYGTYD/QPTDVSYTQAQITATDRQTTYATFYG\QLPTSYTTPSAHLYLPHV*SHFVQVD


Parental protein
GTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPARPQDGNKPAETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPT
..G..DTTTA.VT.TQASY.AQSAYGT.P.YP.YGQQP.AT.PARPQDGNK.AETSQP.SSTGGYN.P.LGYGQ.NYSYPQVPGSYPMQPVTAP.S..PT
Retrocopy
SNGVNDTTTAMVTNTQASYTAQSAYGT*PTYPVYGQQPIATEPARPQDGNKSAETSQPHSSTGGYN*PNLGYGQNNYSYPQVPGSYPMQPVTAPSS-SPT


Parental protein
SYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFS-GPGENR
SYSS.QPT.YDQ..YSQ.NTY..P.................QPPTSYP.QTGSYSQ..SQ.SQQSSSY.QQSSF.QDHPSSM.VY.Q.SGGFS...GEN.
Retrocopy
SYSSAQPTRYDQNRYSQRNTYA*PTXXXXXXXXXXXXXXXKQPPTSYPHQTGSYSQTLSQ*SQQSSSYRQQSSF*QDHPSSMDVYRQDSGGFS/QIGENG


Parental protein
-SMSGPDNRGR-GRGGFDR-GGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN-SAIYVQGLNDNVTLDDLADFFKQCGVVK
..MS.PDN.GR.GRG.FDR.G.M.RGG.G.G..GMGS.GE.GGFNKPG.P...GPDLDLGP.VDPDEDSDN..AIYVQ.LNDNV...DLADF.KQCGVVK
Retrocopy
/NMSEPDNWGR/GRGVFDR\GSMNRGG*GEGCSGMGS-GEQGGFNKPGEPTVKGPDLDLGPSVDPDEDSDN/CAIYVQSLNDNVIPNDLADFIKQCGVVK


Parental protein
M-NKRTGQPMIHIYLDKETGKPKG
..NKRTGQ.M.H.YL.KET..PKG
Retrocopy
R/NKRTGQSMTHSYLGKETEEPKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide