RetrogeneDB ID:
retro_mputfur_574
Organism:
Location:
GL896921.1:4899149-4899492 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.87 %
Coverage:
65.71 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
TPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:12022]

Genomic region (view in browser)





>retro_mputfur_574
GAAAATAGTAGGACAGAAGGTACCATTGATGGAAATGTACTTTGCTGAAGGCCCTGAAAG
TGAAGGTACTAAAAGCACAGTAATCACTGGTGTTGATATTGTCAGGAACTATTACTTACA
GAAAACAAACTTCACAAATGAAGCCTGTGAAAAGTACATCATAGCTTATAGGAAATCAGT
CTAAGGCAAACTTGAAGAACAGGGACCAGAAAGTGTAACCCTTTTATAACAGAGAATGCA
GACAAATCAAGCACATCTTTGTTAATTCAAAAACTGCCAGTTTTTTATTGATGAAAACAT
GAATCCAGATGGCATGGTAGCTCTGCTGAACTTCCATGAGGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EGNIDDSLIGGNAS-AEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERV-KPFMTGAAE-QIKHILAN-FKNYQFF
E.......I.GN...AEGPE.EGT.STVITGVDIV.N..LQ.T.FT.EA..KYI..Y.KS..GKLEEQ.PE.V..PF.T..A..QIKHI..N.FKN.QFF
Retrocopy
ENSRTEGTIDGNVL\AEGPESEGTKSTVITGVDIVRNYYLQKTNFTNEACEKYIIAYRKSV*GKLEEQGPESV/NPFITENAD/QIKHIFVN/FKNCQFF


Parental protein
IGENMNPDGMVALLDYRED
I.ENMNPDGMVALL...ED
Retrocopy
IDENMNPDGMVALLNFHED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide