RetrogeneDB ID:
retro_mputfur_575
Organism:
Location:
GL896921.1:5401039-5401421 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
50.38 %
Coverage:
78.18 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
CFL1
Parental gene aliases:
No gene alias available
Parental gene description:
cofilin 1 (non-muscle) [Source:HGNC Symbol;Acc:1874]

Genomic region (view in browser)





>retro_mputfur_575
AAGGTTTTCTGATATGCAAGTGCACGAGCCATCAGTGCCAGAGGAGGTAAGAGGAAGCAT
AAGAAGGTGGTGCTCTAAGACCTAAGGGAGGACAAGAAGGTCTTCTGGGAGGAGGGCCAG
AAGGTCCTGGTAGGTGATGTGGGCCCATCTGGTGACAACCCCTGTGCCACCTTTGTCAAG
ACACTGGTGGCCAAGAACTGCTGCCACATCCTCTCTGATATGAACTAGGAGATAGAGGAG
AGCCAGAAGGGTTCCTTGGGTTTATCCCCGGGACCCCCAAGTCTGCAGTCCTTAGAGCTG
GATCATATATGCCAGCTCCTAGGATATCAACCAGAAGAAGCTGGTGGAGATCAAGCATGA
ATGACAAGCAAACTGTTGGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKED-LVFIFWAPESAPL
KVF.....R..S......K.KK.VL..L.EDKK....EEG...LVGDVG...D.P.ATFVK.L..K.C...L.D...E..ES.K...L.FI...P.SA.L
Retrocopy
KVF*YASARAISARGGKRKHKKVVL*DLREDKK-VFWEEGQKVLVGDVGPSGDNPCATFVKTLVAKNCCHILSDMN*EIEESQKGS/LGFIPGTPKSAVL


Parental protein
K-SKMIYASSKDAIKKKLTGIKHELQANCYE
..S..IYASS.D...KKL..IKHE.QANC.E
Retrocopy
R/SWIIYASS*DINQKKLVEIKHE*QANCWE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide