RetrogeneDB ID:
retro_mputfur_577
Organism:
Location:
GL896922.1:4964598-4965082 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.62 %
Coverage:
55.22 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
NT5C3A
Parental gene aliases:
No gene alias available
Parental gene description:
5'-nucleotidase, cytosolic IIIA [Source:HGNC Symbol;Acc:17820]

Genomic region (view in browser)





>retro_mputfur_577
AGTCAAGAACCTGCTGTATGTGTGAAAATGAGGTTAAAATTCCCGAAAAGTTCAGTTCAC
GTCAAGAACCCCATAAGAGAAGAAATGACCTTTGGTCTTATCAAAGAAGGTCCTGCCACC
CTTCAGATAATAATGGACTTCAGCATAACACTTAAGTATATTTTCCTACAAAGGAAAAGG
ATGCCCGACATGTCATAATTATCATTGACAATCATAAGCTGGTTACAGATGGAGGCCAGA
AAGAGTTACTGCAACTAAAGGACAAAGACCATGCTACTAAAGTTGATCCTGTTCCTACAA
CAGAAGTACTCTTAGGTGGTAGAACCGTACCCTAACTCACAGGGTTTGCTTGTTGAACAG
GCTCTACTGAAAGCTAAACTGAAAGGAATTGTGGCAGGATCTGATGTCTGTTCAAGGAAG
GTACTAGAATGTCTTTGATAAGCTCCAACAACACAGTCTCCCTGTGTTCAAATTTTCAGC
TGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NQDSAVHVKMMPEFQRSSVRIKNPARVEEIICGLIKGGAGKLQIITDFDMTL-SRFSYEGKRCPTCH-YVIDNSKLITD-ECRKKLLQLKEKYYAIEIDP
.Q..AV.VKM...F..SSV..KNP.R.EE...GLIK.G...LQII.DF..TL.S.FSY.GK.CPTCH...IDN.KL.TD.E.RK.......K........
Retrocopy
SQEPAVCVKMRLKFPKSSVHVKNPIR-EEMTFGLIKEGPATLQIIMDFSITL\SIFSYKGKGCPTCH\IIIDNHKLVTD\EARKSYCN*RTKTMLLKL--


Parental protein
VLTVEEKYPYMVEWYTKSHGLLVEQALPKAKLKEIVAESDV-MLKEG-YENFFDKLQEYGIPVFIFSAG
.L....KY...VE.Y..S.GLLVEQAL.KAKLK.IVA.SDV...KEG.Y.N.FDKLQ....PVF.FSAG
Retrocopy
ILFLQQKYS*VVEPYPNSQGLLVEQALLKAKLKGIVAGSDV/LFKEG/Y*NVFDKLQQHSLPVFKFSAG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide