RetrogeneDB ID:
retro_mputfur_581
Organism:
Location:
GL896923.1:6275067-6275480 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.05 %
Coverage:
65.73 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
Atp5o
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [Source:MGI Symbol;Acc:MGI:106341]

Genomic region (view in browser)





>retro_mputfur_581
ATGGCCACCCCAGCAGTTTCTGGGTTCTCCCAACAGGTGTGATGCTTTAGTACATCTGTG
GTCAGGTTGTTTGCCAAGCACATGAGGCCACCCGTTCAGGTATATGGTATCAAAGGTTGC
TATGCCGCTGCTCTTTATTCTGCTGCATCTAAACAGATGGAACAAGTAGAAAAAGAATTG
TTGAGAGTAGCACAAATATTGAAAGAACCCAAAATGCCTACTTCCATTATGAATCCTTGT
GTAAAGCATACAGTAAAAGTGAAAAGACTAAATGACATGACAGCAAAAGAGATGTTCTCT
CCCCTCATGTCCAGCCTGATCAGTTTGTTTGCTGAAAATGGTTGCTTGAACAATATCCCT
GAGTCATTTTTGCCTTTTCAACCATGCTGAGCATCCAGTGTGGAGAAGTACCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVPAVSGLSRQVRCFSTTVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKMAASIMNPYIKRSVKVKSLNDMSAKER
MA.PAVSG.S.QV.CFST.VVR.F.K..RPPVQVYGI.G.YA.ALYSAASKQ...EQVEKELLRVAQILKEPKM..SIMNP..K..VKVK.LNDM.AKE.
Retrocopy
MATPAVSGFSQQV*CFSTSVVRLFAKHMRPPVQVYGIKGCYAAALYSAASKQ--MEQVEKELLRVAQILKEPKMPTSIMNPCVKHTVKVKRLNDMTAKEM


Parental protein
FSPLTSNLINLLAENGRLDNTPG-VISAFSTMMSVHRGEVP
FSPL.S.LI.L.AENG.L.N.P..VI.AFSTM.S...GEVP
Retrocopy
FSPLMSSLISLFAENGCLNNIPE/VIFAFSTMLSIQCGEVP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide