RetrogeneDB ID:
retro_mputfur_582
Organism:
Location:
GL896923.1:7963323-7963632 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.72 %
Coverage:
62.29 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:12022]

Genomic region (view in browser)





>retro_mputfur_582
TTGATCATCTGCGAGGACCTCTTCAGCCATGATGACATGTTCTCCAACATCTATAAGATC
CAGGAGATTGCAGATGGACTGTGCCTGGAGGCAGGGGGGAAGACAGTCAGTAGGACAGAG
GGTAACCTTGGTGACTCGCTGGTTGGTGGAGATTCCTCTGCTGAAGGCTGGGAGGGTACT
GAAAGCTCAGTCATCCTTGGTGTTGAGACTGTCATGAACCATCCCTTGCAAGAAACCGAC
TTCTACAGAAAGTACATCAAAGATTACACGAAATCAACCAAAGACAAACTTGAAGAACAG
AGGACAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIK
.II..DL.SHD.MFS.IYKI.EIADGLCLE..GK.VSRTEGN..DSL.GG..SAEG...EGTES.VI.GV..VMNH.LQET.F....Y.KYIKDY.KS.K
Retrocopy
LIICEDLFSHDDMFSNIYKIQEIADGLCLEAGGKTVSRTEGNLGDSLVGGDSSAEG--WEGTESSVILGVETVMNHPLQETDF----YRKYIKDYTKSTK


Parental protein
GKLEEQRPE
.KLEEQR.E
Retrocopy
DKLEEQRTE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide