RetrogeneDB ID:
retro_mputfur_585
Organism:
Location:
GL896923.1:12478896-12479900 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.06 %
Coverage:
95.45 %
Frameshifts:
1
Stop codons:
5


Parental gene:
Parental gene symbol:
NUDT9
Parental gene aliases:
No gene alias available
Parental gene description:
nudix (nucleoside diphosphate linked moiety X)-type motif 9 [Source:HGNC Symbol;Acc:8056]

Genomic region (view in browser)





>retro_mputfur_585
CTGGCAAAGTGGTTAGCCATGGTGTCTCTGTCCGTGACCTTGGCCTCTATGGCCTGCAGG
CCCAGCAGCTGCCCCAACATCTCCGCTGGTTGGAACCCGACTTCCTCAGGTGGGTTTCCT
CCAAGCTTCATCATGTCAGATTCAAAGGCCGCTGCTGAGAACCCCCACAAGAAGACCAGG
ACCTCTCCATACCCTGGTTCCAAAGTGGAGGGAAGCCAGGTCCCGGACAAGAAGGTAAGC
TGGCAGGCTGAGTGGCTGGAGTACAAGCCTGTCCAGTACACAGCCAGTTCTGTCTTGACC
TGGTCCATGTGGGCAGACCCTCTGGTGGGTGACAGGAACTTCTCTTCTAAATTCAATGAG
GAGGGTGGGCATGTTGAAAGAAGGAGCCAAAATGGTTTGTATGAGGTGGAGAATGGCAGG
CATAGAAATCCCGCAGGTTGGCCAGTGCTGGTGGGCAGAGGGCTTCTAGGGTGGTGGGGT
CCCAATTAGGCTGCAGATCCCATCTTAACTAAGTGGAAAAATGATAGCAAGGGGAAGAAA
ATTATCCATCCTGCTTCTAAGAGGATTGTCCTGCAATTTGTAGCCATCAAAAGGAAGGAC
TGTGGAGAATGGACCATCCCAGGGGAAATGGTGGAGCCAGGAAAGAAAATTAGTACCATA
CTGAAGACAGAATTTGGGGAGGAAGCCATGAACTCCTTATAGAAATCTAGAGCAAAGACT
TCGGAGCTGGAGAAACAGCTGCACAAACTATTCGATCAGTAACACTTGGTGTCTATAAAG
GTTACATGGATGATCCCCGCAACACAGATAACTCGTGAATGGAGACAGAGGCTGTGAACT
ACCACGATGATACAGGTGAGATAACCGACTGTCTTCATCTGGAAGCTGGTGATGATACCC
AGAAAGTGAAATGGGTAGACATCAATGATCAACTCAAACTTTACGCCAGGCAGTCCCAAT
TTATTCAATACATGGTTGAGAAATGAGGTGCCCATTGGAGGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LGKTLATVSLSVALASVTVKSSGCCSIPACRNTFSSFGFHLSSNIMSTSNGAKENSHNKARTSPYPGSKVQRSQVPNEKVGWFVEWQDYNPVEYTAVSVL
L.K.LA.VSLSV.LAS.....S.C..I.A..N..SS.GF...S.IMS.S..A.EN.H.K.RTSPYPGSKV..SQVP..KV.W..EW..Y.PV.YTA.SVL
Retrocopy
LAKWLAMVSLSVTLASMACRPSSCPNISAGWNPTSSGGFP-PSFIMSDSKAAAENPHKKTRTSPYPGSKVEGSQVPDKKVSWQAEWLEYKPVQYTASSVL


Parental protein
AGPRWADPQISESNFSPKFNEKDGHVERKSQNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKITHPISGKNILQFVAIKRK
....WADP.....NFS.KFNE..GHVER.SQNGLYE.ENGR.RNPAG...LVGRGLLG.WGPN.AADPI.T.WK.DS.G.KI.HP.S....LQFVAIKRK
Retrocopy
TWSMWADPLVGDRNFSSKFNEEGGHVERRSQNGLYEVENGRHRNPAGWPVLVGRGLLGWWGPN*AADPILTKWKNDSKGKKIIHPASKRIVLQFVAIKRK


Parental protein
DCGEWAIPGGMVDPGEKISAALKREFGEEALNSLQKSGAEKKELEEQLHKLFSQEHLV-IYKGYVDDPRNTDNAWMETEAVNYHDETGEVMDNLTLEAGD
DCGEW.IPG.MV.PG.KIS..LK.EFGEEA.NSL.KS.A...ELE.QLHKLF.Q.HLV..YKGY.DDPRNTDN..METEAVNYHD.TGE..D.L.LEAGD
Retrocopy
DCGEWTIPGEMVEPGKKISTILKTEFGEEAMNSL*KSRAKTSELEKQLHKLFDQ*HLV/VYKGYMDDPRNTDNS*METEAVNYHDDTGEITDCLHLEAGD


Parental protein
DAGKVKWVDISDQLQLYASHSQFIKLVAEKRDAHWSE
D..KVKWVDI.DQL.LYA..SQFI....EK..AHW.E
Retrocopy
DTQKVKWVDINDQLKLYARQSQFIQYMVEK*GAHWRE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide