RetrogeneDB ID:
retro_mputfur_587
Organism:
Location:
GL896923.1:4251339-4252595 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.87 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
PRIM1
Parental gene aliases:
No gene alias available
Parental gene description:
primase, DNA, polypeptide 1 (49kDa) [Source:HGNC Symbol;Acc:9369]

Genomic region (view in browser)





>retro_mputfur_587
ATGGAGACGTTTGACCCTGCCGAGCTGCCCAAACTGCTTAAGCTTTATTACTGGAGGCTT
TTTCCCTACGCCCAGTACTACTGTTGGCTCAACTATGGCGGAGTAATAAAGAATTACTTT
CAACACTGTGAATTTTCATTCACATTGAAAGATATTTACATTCGCTCCCAATCCTTCAAC
AACCAGAGTGAGCTGGAAAAGGAGATGCAGAAAATGAATCCATACAAGATTGATATAGGC
GCAATATATTCCCACAGACCCAATCAGCACAATACAGTGAAGCTGTGAGCTTTCCAGGCT
CAAGAAAAAGAACTGGTGTTTGACATTGATATGACAGACTATGACAATGTGAGGAGATGT
TGTAGTTCTGCAGACATATGTTCTCAGTGCTGGACCCTCGTGACGATGGCCATACACATA
ATCGACCGAGCACTGAAGGAGGACTTTGGATTTCAGCATCGTCTCTGGGTATATTCTGGA
AGGAGAGGTGTTCATTGTTGGGTCTGTGATGAATCGGTTAGAAAACTCTCCTCTGCAGTA
CATTCTGGGATAGTTGAGTATTTGAGTCTTGTAGAGGGTGGTCAAGATGTTAAAAAGAAA
GTCCATCTAAGTGAAAAAATTCACCCTTTTGTCAGCAAATCTATAAACATAATAAAAAAA
ATACTTCCAAGAATATGCCTTAGTTGATCAAGATATTCTTGAAAATAAAGAAAGGTGGGA
TAAGATTTTAGCCCTTGTTCCTGAAACAATTCATGAGCCACTTCAGCAAAACTTCCCGAA
GTATCACAATTTACTTCAGCGTTGGGAATATTTGACGAAAGCCATCAGCTTGCAGGATAG
TACCAAAAATGACAAATGTGGACCCTGGCTGGAATGGGAGATCATGCTCCAGTACTGTTT
CCCACGGCTGGACATCAATATTAGCAAAGGAATCAATCATTTACTGAAGAGCCCCTTTAG
TGTTTCATCCTAAAACAGGTCGTATTTCTGTGCCTATTGATTTACAGAAAGTGGAACAGT
TTGATCCATTTACTGTTCCAACCATAAGCTCTCTCTGCCGTGAATTGGATGCCATTTCCA
TTAATGATGAGGGAAAAGAAGGAAATGAAGCCGATTCTGATATCAAACGTAGAACCAGAG
ATTATAAGAAGACCAGTCTAGCTCCTTATATAAAAGTTTTTGAACAATTTCTTGCAAACC
TGGATAAATCCCGAAAAGGAGAACTTCTCGATAAGAGTGATTTACAGAAAGACTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
METFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVIKNYFQNREFSFTLKDDIYIRYQSFNNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQ
METFDPAELP.LLKLYY.RLFPYAQYY.WLNYGGVIKNYFQ..EFSFTLKD.IYIR.QSFNNQSELEKEMQKMNPYKIDIGA.YSHRPNQHNTVKL.AFQ
Retrocopy
METFDPAELPKLLKLYYWRLFPYAQYYCWLNYGGVIKNYFQHCEFSFTLKD-IYIRSQSFNNQSELEKEMQKMNPYKIDIGAIYSHRPNQHNTVKL*AFQ


Parental protein
AQEKELVFDIDMTDYDDVRRCCSSADICSKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKK
AQEKELVFDIDMTDYD.VRRCCSSADICS.CWTL.TMAI.IIDRALKEDFGF.HRLWVYSGRRGVHCWVCDESVRKLSSAV.SGIVEYLSLV.GGQDVKK
Retrocopy
AQEKELVFDIDMTDYDNVRRCCSSADICSQCWTLVTMAIHIIDRALKEDFGFQHRLWVYSGRRGVHCWVCDESVRKLSSAVHSGIVEYLSLVEGGQDVKK


Parental protein
KVHLSEKIHPFVSKSINI-IKKYFQEYALVDQDILENKESWDKILALVPETIHETLQQNFPKYHNSLQRWEYLMKAISLQDSTKNDKCGPYLEWEIMLQY
KVHLSEKIHPFVSKSINI....YFQEYALVDQDILENKE.WDKILALVPETIHE.LQQNFPKYHN.LQRWEYL.KAISLQDSTKNDKCGP.LEWEIMLQY
Retrocopy
KVHLSEKIHPFVSKSINI\XXXYFQEYALVDQDILENKERWDKILALVPETIHEPLQQNFPKYHNLLQRWEYLTKAISLQDSTKNDKCGPWLEWEIMLQY


Parental protein
CFPRLDINVSKGINHLLKSPFSV-HPKTGRISVPIDLQKVEQFDPFTVPTISSLCRELDAISINDEGKEGNEAESDIKRRTRDYKKTSLAPYIKVFEQFL
CFPRLDIN.SKGINHLLKSPFSV.HPKTGRISVPIDLQKVEQFDPFTVPTISSLCRELDAISINDEGKEGNEA.SDIKRRTRDYKKTSLAPYIKVFEQFL
Retrocopy
CFPRLDINISKGINHLLKSPFSV\HPKTGRISVPIDLQKVEQFDPFTVPTISSLCRELDAISINDEGKEGNEADSDIKRRTRDYKKTSLAPYIKVFEQFL


Parental protein
ENLDKSRKGELLKKSDLQKDF
.NLDKSRKGELL.KSDLQKDF
Retrocopy
ANLDKSRKGELLDKSDLQKDF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide