RetrogeneDB ID:
retro_mputfur_588
Organism:
Location:
GL896923.1:5386190-5386650 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.82 %
Coverage:
83.42 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
TMEM147
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 147 [Source:HGNC Symbol;Acc:30414]

Genomic region (view in browser)





>retro_mputfur_588
CTCTTCCTGGCCATGTTTTTTTTCCTTCTAAGGCCATGTTTTTTTCCCACCTGGGAAGGC
AGCATCTGTGACTTCATTAGGATGTCATGAAGGTCATCGTGAATGTGGCAGACCAGATAC
ATCTAAACTTTGTCATGTCCTGGAATGTATGCAAAGGGGAGTACAGGATCATGGTTGCTG
TCTTGGGCTGGGCTATGGCCATGCTCATTATGTCCCGCTCCTTCTCATCTGAGTTGGAGC
CCAGAGCATTGAGTTTGACTGGAAGTACATCCAGAAGAGCATGGACTCCAATATCAGGCT
GGTCCATTACATCATCTCATTTGCCCAGGTCTAGATGATAACACACTACAACCCATACCA
CACTTTTCAGCCAGCAGTGCTCCTACTGTCCTTAGTCTATGAGGCCTTTGTCATGGAGAC
CTTCATCCACCTCTGTTCCCTGGGCAGCTGGACAGCACTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LFVQLCKMLFLATFFPTWEGGIYDFIG-EFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIP-LWVGARGIEFDWKYIQMSIDSN
LF......L....FFPTWEG.I.DFI....MK..V.VAD.I.LN.VMS.N..KGEY.IMVA.LGWA.A.LIMSR......VGA..IEFDWKYIQ.S.DSN
Retrocopy
LFLAMXXXLLRPCFFPTWEGSICDFIR/DVMKVIVNVADQIHLNFVMSWNVCKGEYRIMVAVLGWAMAMLIMSRSFS/I*VGAQSIEFDWKYIQKSMDSN


Parental protein
ISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWTAL
I.LVHYI...AQV.MIT.Y..YHTF.PAVLLL....VY.AFVMETF.HLCSLGSWTAL
Retrocopy
IRLVHYIISFAQV*MITHYNPYHTFQPAVLLLSL--VYEAFVMETFIHLCSLGSWTAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide