RetrogeneDB ID:
retro_mputfur_590
Organism:
Location:
GL896923.1:5653312-5653685 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.0 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
LAMTOR3
Parental gene aliases:
No gene alias available
Parental gene description:
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606]

Genomic region (view in browser)





>retro_mputfur_590
ATGGTAAATGACCTGAAGTGATTTCTGCATACAAAACTACCAAGCGTTGAAGGGCGCCGT
GCTGTGGTTGTGTCAGATAGAGACGGAGTGACTGCTGTTGGAGTGGCTGGTGATAAATGT
CCCAGAGCATGCTGGGAGACCTGGTCGCTTATCTACTTTTGCCTTTGCATCAGACCGAGG
AAGCAAACTCGGACTTTCAAAAAATAAAAGGATCAGCTGTTACGATAACACCCATCAGGT
GGTTCAATTCAGTCATTTACCTTTGGTGGTGAGTTTCACAGCCAGCGGCAATGCCAACAC
AGAACTCACTATCAGCCTAGAAAGGGAGCTTGCTCTGTGGTTTGAAGAATTGAGACAAGT
CATGGAAGTTTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVAND-NAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNAN
M..DLK.FL..KLPSVEG..A.VVSDRDGV....VA.D.N.PEHA.RPG.LSTFA.A.D.GSKLGLSKNK.I.CY.NT.QVVQF..LPLVVSF.AS.NAN
Retrocopy
MVNDLK*FLHTKLPSVEGRRAVVVSDRDGVTAVGVAGD\NVPEHAGRPGRLSTFAFASDRGSKLGLSKNKRISCYDNTHQVVQFSHLPLVVSFTASGNAN


Parental protein
TGLIVSLEKELAPLFEELRQVVEVS
T.L..SLE.ELA..FEELRQV.EVS
Retrocopy
TELTISLERELALWFEELRQVMEVS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide