RetrogeneDB ID:
retro_mputfur_591
Organism:
Location:
GL896923.1:9630749-9630995 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.05 %
Coverage:
63.08 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS15A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S15a [Source:HGNC Symbol;Acc:10389]

Genomic region (view in browser)





>retro_mputfur_591
AAATTTGAAATCATTGATGATCACAAAGCAGGGAAAATTGTTGTGAACCTCATGGGCAGG
TTAAACAAGTGAGGAATAATCAGCCCCAGATTTGATGTACAACTCAAAGATCTAGAAAAA
TGGCAGAATCATGGGCTCCAGTTCTCCCAGTTTGGTTTCACTGTACTGACAACCTCAGCT
CGCATCAGGGACCATGAGGAAGAAAGTCGAAATAACATAGGAGGGAAAATCCTGGGATTC
TTTTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF
.FEIIDDH.AGKIVVNL.GRLNK.G.ISPRFDVQLKDLEKWQN..L...QFGF.VLTTSA.I.DHEE..R...GGKILGFFF
Retrocopy
KFEIIDDHKAGKIVVNLMGRLNK*GIISPRFDVQLKDLEKWQNHGLQFSQFGFTVLTTSARIRDHEEESRNNIGGKILGFFF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide