RetrogeneDB ID:
retro_mputfur_592
Organism:
Location:
GL896923.1:13010354-13010945 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.04 %
Coverage:
94.29 %
Frameshifts:
5
Stop codons:
1


Parental gene:
Parental gene symbol:
NDUFS8
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7715]

Genomic region (view in browser)





>retro_mputfur_592
CTGGCCCAGCCTGCCCTCACAGGGTATTCCACTGGCCACACCCTTGTGGGCATGACCTAC
AAGCTCTTGAACATGCAGAAGCCATCATGAACATGAAGTCAGTGACTGGTAGGGCACTCA
GGACCTGCTGTGGTCTGAGTTCTTCCGAGGCCTGGGCATGACCCTGAACTACCTGTTCCA
GGAGCCCCTTGTCATCAACTACCCACTCAAGAAGGGCCAGCTGAGCCCACGCTTACAGGG
GGGCAGGGCTGCACGCATTGTGCCACTACCCATCTGGAGAGGAGCACTGCCTGCCTTGCC
TATAAGATTTGTGCAGCTGTTTGCCCCATCCAGGCCATCACCACCAAGGCTGAGCCCACC
GCCAGTGGCAGCTGCCAGGCCACCCACTAAGACATGGATATGACCAAATGCATCTACTGT
GGCTTCTGCCACATGGCCTGCCTCATGGACGCCAGCACCAAGGGTCCCAACTTTGAGTTC
CCCGCGGAGATACACAAGTTGCTGCTGTACAACAGGAGAAACTGCTCAGCAATGGGGGCA
GGTGGGAAGATGAGATGTCCCGCCAACATCCAGGCTGACGACCTTTATCGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LAQAARAGQPAGRSLHGSSGAATYKFVNMQEPS-MDMKAVTDRAAQT-LLWTELIRGLGMTLSYLFREPATINYPFEKG-PLSPRFRG----EHALRRYP
LAQ.A..G...G..L.G.....TYK..NMQ.PS.M.MK.VT.RA..T.LLW.E..RGLGMTL.YLF.EP..INYP..KG.P..P...G.....H......
Retrocopy
LAQPALTGYSTGHTLVGM----TYKLLNMQKPS/MNMKSVTGRALRT/LLWSEFFRGLGMTLNYLFQEPLVINYPLKKG/PAEPTLTGGQGCTHCATTHL


Parental protein
SGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNK-EKLLSNGDKWEAEIA-ANI
.....C.A.K.C.AVCP.QAIT..AEP.A.GS...T..D.DMTKCIYCGFC..AC..DA...GPNFEF..E.H..LLYN..EKLLSNG..WE.E...ANI
Retrocopy
ERSTACLAYKICAAVCPIQAITTKAEPTASGSCQATH*DMDMTKCIYCGFCHMACLMDASTKGPNFEFPAEIHKLLLYNR/EKLLSNGGRWEDEMS\ANI


Parental protein
QADYLYR
QAD.LYR
Retrocopy
QADDLYR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide