RetrogeneDB ID:
retro_mputfur_598
Organism:
Location:
GL896924.1:273907-274286 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.0 %
Coverage:
74.14 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
TIMM17A
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:HGNC Symbol;Acc:17315]

Genomic region (view in browser)





>retro_mputfur_598
CAGGCAGTCAAAGGTTTTTGCAATTCTCCAGTGGGAGTAAATCACAGACTATGAGGGAGT
TTGAAAGCTATTAAAACCAGGGTTCTGCACTTGGGGGGTAGCTTTGCAGTTTGGGGAGTT
TTATTTTCCATAGTTGACTGCAGTATGGTTAAGGTCAGAGGGAAAGAAGATCCCTAGACC
TCCATCACAAGTGGTGCCGTAATAGGAGCCATACTGGCAGTAAGGAATGGACCAGTGGCC
GTGGTTGGGTCAGCCATGATGGGTGGCATTCTCCTAGCTTCGACTCAAGGAGCTGGGATC
TTGCCAACAAGATTCACCTCTGCACATTTCCCAGTGTCCTCCGTTTGCAGAAGACCCTTC
AACCCGGCTACCATCCTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGDKTGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEG
QA.KGF.NSPVGVNHRL.GSL.AIKTR...LG...GSFAVWG.LFS..DCSMV.VRGKEDP..SITSGA..GAILA.RNGPVA.VGSA.MGGILLA...G
Retrocopy
QAVKGFCNSPVGVNHRL*GSLKAIKTRVLHLG---GSFAVWGVLFSIVDCSMVKVRGKEDP*TSITSGAVIGAILAVRNGPVAVVGSAMMGGILLASTQG


Parental protein
AGILLTRFASAQFPNG-PQFTEDPSQLPSA
AGIL.TRF.SA.FP...P........LPS.
Retrocopy
AGILPTRFTSAHFPVS\PFAEDPSTRLPSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide