RetrogeneDB ID:
retro_mputfur_60
Organism:
Location:
GL897009.1:978788-979331 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.89 %
Coverage:
95.74 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Mitochondrial ribosomal protein L32 [Source:UniProtKB/TrEMBL;Acc:G9KBB8]

Genomic region (view in browser)





>retro_mputfur_60
ATGGCGTCAACCATGCTGGTGCTCATCTTTCCACCCTGGCCCGCCGCCCAGGGACTCCTC
TGGAGCTGTTGGAAACTGCTACAGTGGAAACTTCAGCAGACAGGGCCAGGTTTACCCAGT
CCTCTGTGGGAAGTGGCATTAGCAGTCCAAGGTCCAGCTGTATTTACAGAACCAGCAAAT
GATACCAATGGAAGTAAGGAGATTCCCAGGCTTTCAGATAGTATCTTTTGGATGGCAGCT
CCGAAAAACAGACTCAGCATTGAAGTTAACCGCTGTAGGAGAAGAAACCCTCAGAAAATT
ATTAAAGTTAAGAACAATATTGATGTTTGTCCTGAATGTGGTCACCTGAAATTGAAACAC
ATCCTTTGTGGCTATCGCTATGAGAAGGTGTGCAAGGAGACTGCAGAAATCAGAAGACAG
ATGGGGAAACAAGAAGGGGCCCCTTTTAAGGCTCCTTCTGTGGAGACTGTGGTGCTGTAC
ACAGGAGAGGTACCATCTGAACAAGATCGTGGTAAGAGAATCAGTGAACGAAACAGGAAG
TGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASTMLVLVFPRWPAARGLLRSCWDLLQRKLQQTGPGLPSPPWGPALAIQGPAVFTEPANDTNGSKEIPSLSDSIFWMAAPKNRRSIEVNRCRRRNPQKL
MASTMLVL.FP.WPAA.GLL.SCW.LLQ.KLQQTGPGLPSP.W..ALA.QGPAVFTEPANDTNGSKEIP.LSDSIFWMAAPKNR.SIEVNRCRRRNPQK.
Retrocopy
MASTMLVLIFPPWPAAQGLLWSCWKLLQWKLQQTGPGLPSPLWEVALAVQGPAVFTEPANDTNGSKEIPRLSDSIFWMAAPKNRLSIEVNRCRRRNPQKI


Parental protein
IKVKNNIDVCPECGHLKLKHVLCGYCYEKVCKETAEIRRQMGKQEGGPFKAPSVETVVLYAGEVPSEQDLGKRIIERDRK
IKVKNNIDVCPECGHLKLKH.LCGY.YEKVCKETAEIRRQMGKQEG.PFKAPSVETVVLY.GEVPSEQD.GKRI.ER.RK
Retrocopy
IKVKNNIDVCPECGHLKLKHILCGYRYEKVCKETAEIRRQMGKQEGAPFKAPSVETVVLYTGEVPSEQDRGKRISERNRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide