RetrogeneDB ID:
retro_mputfur_600
Organism:
Location:
GL896925.1:383721-384236 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.49 %
Coverage:
65.15 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_600
CTTCAGAAGTATTTTGGAGCCTTTGGAGAGATGGAGAATATTGAACTTCCCATGGATACA
AAAACAAACGAAAGAAGAGGATTTTGTTTTACCACATATACAGATGAAGAGCCAGTAAAG
AAATTGTTAGAAAGCAGATATCATCAAATCGGTTCTGGGAAGTGTGAAATCAAAGTTGCA
CAACCCAAAGAGGTATACAGGCAGCAACAGTAGCAACAAAAAGGAGGAAGAGGTGCTGCA
GCCGGTGGAGGAGGTGGTACTAGGGGTCGTGGACGAGGTCAGGGCCAAAACTGGAACCAA
GGATTTAATAACTATTATGACCAAGGATATGGAAATTACAATAGTGCCTATGGTGGTGGT
CAAAACTATAGTGGCTATGGCGGCTATGATTATATGGGTATAACTATGGAAACTATGGAT
ATGGACTGGGATATGCAGACTACAGTGGCCAAGAGAGCACTTACGGCAAGGCGTATCGAG
GGGGTGGCAATCACCAAAACAATTACCAGCCATAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQ
...YFGAFGE.ENIELPMDTKTNERRGFCF.TYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQ.QQKGGRGAAAGG.GGTRGRGRGQGQNWNQ
Retrocopy
LQKYFGAFGEMENIELPMDTKTNERRGFCFTTYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQ*QQKGGRGAAAGGGGGTRGRGRGQGQNWNQ


Parental protein
GFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYT-GYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
GFNNYYDQGYGNYNSAYGG.QNYSGYGGYDY..GYNYGNYGYG.GYADYSGQ.STYGKA.RGGGNHQNNYQPY
Retrocopy
GFNNYYDQGYGNYNSAYGGGQNYSGYGGYDYM/GYNYGNYGYGLGYADYSGQESTYGKAYRGGGNHQNNYQPY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide