RetrogeneDB ID:
retro_mputfur_603
Organism:
Location:
GL896926.1:666810-667307 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
77.84 %
Coverage:
60.81 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_603
CAAAGAGCCATTTCTAGAGAGGTTTCTGTAAAGCCTGGTGCCCATCTAACAGGAAGAAAG
TTTTTGTTGGTGGTATTAAAGAAGATACAGAAGAATATAATTTGAGAGACTACTTTGAAA
AGTACGGCAAGATTGAAACCATAGAAGTCATAGAAGACAGGCAGAGTGGAAAAAAGAGAG
GATTTGCCTTTTTAACTTTTGATGACCATGAAACAGTTGATAAAGTTGTTATTCAGAAAT
ACTACACTATTAATGGGCATAATTGTGAAGTGAAAAAGGCTCTTTCTAAATAAGAAATAC
AGTTTGCTGCATCACAAAGAGGTTGTGGAGGTGGGTCTGGCAACTTCATGGGTTGTGGAG
GAAACTTTGGAGGTGGTGGTAACTTTGGCCATGGTGGAAACTTTGGTGGAAGAGGAGGCC
ATGGTGGTGGAGGTGGTGGCAGCAGAGGTAGTTATGGGGGAGGTGATGGTGGACATAATG
GATTTGGAGGTGATGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KRAVSREDSVKPGAHLTV-KKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQE
.RA.SRE.SVKPGAHLT..KK.FVGGIKEDTEEYNLRDYFEKYGKIETIEV.EDRQSGKKRGFAF.TFDDH.TVDK.V.QKY.TINGHNCEVKKALSK.E
Retrocopy
QRAISREVSVKPGAHLTG/KKVFVGGIKEDTEEYNLRDYFEKYGKIETIEVIEDRQSGKKRGFAFLTFDDHETVDKVVIQKYYTINGHNCEVKKALSK*E


Parental protein
MQSAGSQRGRGGGSGNFMGRGGNFGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDG
.Q.A.SQRG.GGGSGNFMG..................GRGG.GGGGGGSRGSYGGGDGG.NGFGGDG
Retrocopy
IQFAASQRGCGGGSGNFMGXXXXXXXXXXXXXXXXXXGRGGHGGGGGGSRGSYGGGDGGHNGFGGDG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide