RetrogeneDB ID:
retro_mputfur_604
Organism:
Location:
GL896926.1:4924631-4925012 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.79 %
Coverage:
53.39 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
TPM3
Parental gene aliases:
No gene alias available
Parental gene description:
tropomyosin 3 [Source:HGNC Symbol;Acc:12012]

Genomic region (view in browser)





>retro_mputfur_604
GAAGAGGAACTGGACCATGCCCTGCAAAAACTGAAGGAAGCCGAGAAAGTTGCTGATGAG
AGTTAAGAGTGGTATGAAGCTTTTACCGAAAGCTGAGCCTTAAAAAGATGAAGAAAAGAT
GGAACTCCGGAAATCCAACTCAAACAAGCTGAGCACACTGCAGAAGAAGCAGACTAGAAG
TATGAAGGGGTGTCTCAGAAGTTAGTGATTACTGAGGGGGACCTGGAATGCACAGAGGAA
TGAGCTGAGCTGGCAGACTCCCATTGCCAGGAGGTGGATAAGCAGATAAGACAGACGGAC
CGGAACCTAAAGTGGCTGAGTGATGCACAAGAAAAGTACTCTCAAAAGAGAGACAAGAAG
AAATAAAGATTCTCACTGTTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QERLATALQKLEEAEKAADES-ERGMKVIENRAL-KDEEKMELQ-EIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRL
.E.L..ALQKL.EAEK.ADES...GMK........KDEEKMEL..EIQLK.A.H.AEEAD.KYE.V..KLVI.EGDLE.TEE.AELA.S.C.E.D.QIR.
Retrocopy
EEELDHALQKLKEAEKVADES\KSGMKLLPKAEP*KDEEKMELR/EIQLKQAEHTAEEAD*KYEGVSQKLVITEGDLECTEE*AELADSHCQEVDKQIRQ


Parental protein
MDQNLKCLSAAEEKYSQKEDKYEEEIKIL
.D.NLK.LS.A.EKYSQK.DK.......L
Retrocopy
TDRNLKWLSDAQEKYSQKRDKKK*RFSLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide