RetrogeneDB ID:
retro_mputfur_606
Organism:
Location:
GL896926.1:7810371-7810704 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
96.4 %
Coverage:
55.5 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Apool
Parental gene aliases:
No gene alias available
Parental gene description:
apolipoprotein O-like [Source:MGI Symbol;Acc:MGI:1915367]

Genomic region (view in browser)





>retro_mputfur_606
CGAAAAGGTTCTAGGTTTAAGAAAATTGCTTATCCACTGGGGCTGGCCACTTTAGGAGCA
ACTGTTTGCTACCCAGTTCAGTCAGTAATAATTGCAAAGGTAACTGGGGAAAAGGCATAT
ACTGTAAGCCAGCAAATTTATGGAGCAGTTAAATCATTGCGGACAAAAAGCAACAAAGAA
GAATCACTTCCTAAACCTAAAGAAAAATCTAAGCTAGGAAATTCTGCTACACTAGAAATA
CCTGCAAAAACAACTGGCAGCCTGAAATACTCAGTTTCCTTGCCAGCAGAACTCAGCTCT
GAAACAAAGACAAAATCAGAATCCATCTCAGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RKXSRFKKIAYPLGLATLGATVCYPVQSVIIAKVTGEKAYTVSQQIYGAVKSLRTKSNKEESLPKPKEKSKLGNSATLEIPEKTTDSLKYSVSLPAELSS
RK.SRFKKIAYPLGLATLGATVCYPVQSVIIAKVTGEKAYTVSQQIYGAVKSLRTKSNKEESLPKPKEKSKLGNSATLEIP.KTT.SLKYSVSLPAELSS
Retrocopy
RKGSRFKKIAYPLGLATLGATVCYPVQSVIIAKVTGEKAYTVSQQIYGAVKSLRTKSNKEESLPKPKEKSKLGNSATLEIPAKTTGSLKYSVSLPAELSS


Parental protein
ETKTKSESTSG
ETKTKSES.SG
Retrocopy
ETKTKSESISG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide