RetrogeneDB ID:
retro_mputfur_608
Organism:
Location:
GL896926.1:9686469-9686686 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.49 %
Coverage:
55.81 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
PFDN6
Parental gene aliases:
No gene alias available
Parental gene description:
prefoldin subunit 6 [Source:HGNC Symbol;Acc:4926]

Genomic region (view in browser)





>retro_mputfur_608
GAAGCTTGAGGTGCAGAAAGTAGTATCGTGAAAGAGGAGCTGGCTTGGCTAGATAGGTCC
AACATGGTCTTTAAATTTCTGGGTCTTGTGCCGGTCAAACAGGAGCTGGGAGAGGCTCAG
GCCATAGTGGGGGAAGAGGCTGGACTATATCACAGCTGAAATTCAGTGATAGGAGTCCCA
GCTCCAGGACCTTGCTAGTCAGAGCAAAAGAGGGAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATV-GKRLDYITAEIKRYESQLRDLERQSEQQR
EA...E..IVKEELA.LD.SN.VFK.LG.V.VKQELGEA.A.V.GKRLDYITAEI...ESQL.DL..QS...R
Retrocopy
EA*GAESSIVKEELAWLDRSNMVFKFLGLVPVKQELGEAQAIV\GKRLDYITAEIQ**ESQLQDLASQSKRGR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide