RetrogeneDB ID:
retro_mputfur_609
Organism:
Location:
GL896926.1:10857361-10858288 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.4 %
Coverage:
73.46 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
EEF1A2
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:3192]

Genomic region (view in browser)





>retro_mputfur_609
GCTGTCCTGATTGTTGTCGCTGTGTTGGTAAATTTGAAGCAGGTTTCTTCAAGAATGGGC
AGATCTGTGAGTGTGCCCTTCTGGGTTACACACTGGGTGTACAACAACTAATTGTTGGTG
TTAACAAAATGGATTCCACTGAGCCACCCTATAGCCAGAAGAGATAAGAGGAAATTGTTA
AGGAAGTCAGTACCTACATTAAGAAAATTGGCTACAACCCCGACACAGTAGCATTTGTGC
CAGTTTCTGGTTGGAATGGTGACAACATGCTGGAGCCAAGTGCTAACATGCCTTGGTTCA
AGGGATGTAAAGTCATCCATAAAGATGGGAATGCCAGTGGAACCATACTGCTTGAAGCTC
TGGATTTCATTTTGCTTCACCTCGTCTACCTGACAAGCCCTTGTGTCTGCCTGTCCAGGA
TGTCTACAAAATTGGTGGTATTGGTTCTCTCCCTGTGGGCTGAGTGAATACTGGTGTTCT
TAAATCTGGCATGGTGGTCACCTTTGCTCCAGACATTGTTACAATTGAAGTAAAGTCTGT
TGAAATGCACCATGAAGCTTTGAGTGAGGCTCTTCCTGGGGACAGTGTGGACTTCAAGGT
CAAGAACATATCTGTCAAAGATGTTTGTTGTCACATTGTGGCTGGAGACAGCAAAAATGA
CCCACCAGTGGAAGCAGCTGGTTTCACAGCTCAGGTAATTATCCTGAACCATCCAGGCCA
AATTAGTGCTGGATATGCACCTGTGCCGGATTGTCACATAGCTCATATTGTTTGCAAGTT
TGCTAAGTGGAAGGAGAACATAGATCATCCTTCTGAAAAAAAGCTGAAGATAGTCCCAAG
TTCTTGAAGTCTGGTGATGCTACCATTGTTGATATGGTTCCTGGCAAGCCTATGTATGTT
GAGAGCTTCTCTGACTATCCTCCTCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AVLIVAAG-VGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPW
AVLIV.A..VG.FEAG..KNGQ..E.ALL.YTLGV.QLIVGVNKMDSTEP.YS.KR..EIVKEVS.YIKKIGYNP.TV.FVP.SGW.GDNMLEPS.NMPW
Retrocopy
AVLIVVAV/VGKFEAGFFKNGQICECALLGYTLGVQQLIVGVNKMDSTEPPYSQKR*EEIVKEVSTYIKKIGYNPDTVAFVPVSGWNGDNMLEPSANMPW


Parental protein
FKGWKVERKEGNASGVSLLEALDTIL-PPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVG
FKG.KV..K.GNASG..LLEALD.IL....R..DKPL.LP.QDVYKIGGIG..PVG.V.TGVL..GMVVTFAP...T.EVKSVEMHHEALSEALPGD.V.
Retrocopy
FKGCKVIHKDGNASGTILLEALDFIL/ASPRLPDKPLCLPVQDVYKIGGIGSLPVG*VNTGVLKSGMVVTFAPDIVTIEVKSVEMHHEALSEALPGDSVD


Parental protein
FNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKL-EDNPKALKSGDAAIVEMVPGK
F.VKN.SVKD.....V.GDSK.DPP.EAA.FT.QVIILNHPGQISAGY.PV.DCH.AHI.CKFA..KE.ID..S.KKL.ED.PK.LKSGDA.IV.MVPGK
Retrocopy
FKVKNISVKDVCCHIVAGDSKNDPPVEAAGFTAQVIILNHPGQISAGYAPVPDCHIAHIVCKFAKWKENIDHPSEKKL/EDSPKFLKSGDATIVDMVPGK


Parental protein
PMCVESFSQYPPL
PM.VESFS.YPPL
Retrocopy
PMYVESFSDYPPL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide