RetrogeneDB ID:
retro_mputfur_610
Organism:
Location:
GL896926.1:12781548-12782235 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.09 %
Coverage:
55.82 %
Frameshifts:
2
Stop codons:
9


Parental gene:
Parental gene symbol:
ARIH2
Parental gene aliases:
No gene alias available
Parental gene description:
ariadne homolog 2 (Drosophila) [Source:HGNC Symbol;Acc:690]

Genomic region (view in browser)





>retro_mputfur_610
CATTCCTAGCTCCAGCTGTGCTCTGGTGCGGATTGCCCCCTGGTGATTCATGTATAGAAG
TCCAGAGCTTGCTAAGTACAGTCCAATCAGTGCAATGAGGTCTTCTGTTTCAAGTTGTCA
AATGTGTCATGTGCCAGTCTATGCCACGATCTGGAAATGGCTCAGGAAATGTGCTGGTGA
CTCTGAAACAGCCAACTACCTAGGTGCTCACGCTTAAGACTATCCCAAGTGCAACTTCTG
CATTGAGAAGAGCAAAGGCTGCAATCACATGTGATGCTCCAACTGTAATCATGACTTCCA
CTGGATATGTCTAGGAGATTAGAAGACCCACAGCAGCAAGTACTATAACTGCAGCTGGAA
CAAGTAGAACTCTGACACTGTCGACCAGATCCAACAAGCCCAGGCCAGGAAGAAGTCCTT
GTCCTACTTTGAGAGGGGGAAAGCCATAAGAGCTTGCAGCTGAAGGTGCAGATTTAGCAG
TGGATTCATGAGAAGATTCAGAAGAGGGACATGAACAATCTGGGGACCTGGAATGACTGG
CAGCACCTACAGAATGCTGTCACGCTCTTGGCCAAGTGCTGATACACCCTGCAGGACCCA
TGTCCATGTACATATTACATGGAGTCTGGACCCAGGAAGAAGCTATTGGAACACCAGCAG
GCTCAGCTGCAGGCTGTCATGGAAAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HYQLQLCPGADCPMVIRVQEPRARRVQCNRCNEVFCFK-CRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKH
H..LQLC.GADCP.VI.V...RA..VQ.N.CNEVFCFK.C.QM.H.P...ATI.KWL.KCA.DSETANY..AH..D.PKCN.CIEK..GCNHM.CS.C.H
Retrocopy
HS*LQLCSGADCPLVIHV*KSRAC*VQSNQCNEVFCFK\C-QMCHVPV-YATIWKWLRKCAGDSETANYLGAHA*DYPKCNFCIEKSKGCNHM*CSNCNH


Parental protein
DFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFER-WENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAK
DF.W.CLGD.KTH.S.YY.CS..K.N.D.V.Q.QQAQAR...KK.L.YFER..E.H.KSLQL..Q..Q.IHEKIQ.R.MNNLGTW.DWQ.LQNA..LLAK
Retrocopy
DFHWICLGD*KTHSSKYYNCSWNK*NSDTVDQIQQAQAR---KKSLSYFER/GESH-KSLQLKVQI*QWIHEKIQKRDMNNLGTWNDWQHLQNAVTLLAK


Parental protein
CRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIEN
C.YTLQ...P..YYMESGPRKKL.E.QQAQL.A..E.
Retrocopy
C*YTLQDPCPCTYYMESGPRKKLLEHQQAQLQAVMES


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide