RetrogeneDB ID:
retro_mputfur_611
Organism:
Location:
GL896926.1:13281493-13281835 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.65 %
Coverage:
80.99 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
POLR2D
Parental gene aliases:
No gene alias available
Parental gene description:
polymerase (RNA) II (DNA directed) polypeptide D [Source:HGNC Symbol;Acc:9191]

Genomic region (view in browser)





>retro_mputfur_611
ACGGCTGAGACACTACTAAATTCAGAAGTCCATACACTTCTGGAACCTCAAAATCAGTAG
AATGAGAGTTTAGAGGATGAACAGGAACTTTCTGAGGTCTTCAATAAAACTCTAAATTAC
ACATGGACCATTTTCGTTGTTTTAAAAACAGAGACCATTGCCAATGTCTGTAGCTTGTTG
CTCCTGAAGAAGCTTCATGAGTTTGCATTGGCCTGTTTGGCCAGCCTTGGCCCAGAGACT
GCTGAGGAGTCGAAGGCACTGATACCAAGCCTGGAGGGGTGGTTTGAAGATGAGGAGCTA
CAGCAGATACCTGATAACCAGACCAAGTGCAGCTTTCAATAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEEL
TAETLLNSEVH.LLE...Q.NES.EDEQELSEVF.KTLNYT.........ETIA.V.SLLL.KKLH.F.LACLA.L.PETAEESKALIPSLEG.FEDEEL
Retrocopy
TAETLLNSEVHTLLEPQNQ*NESLEDEQELSEVFNKTLNYTWTIFVVLKTETIANVCSLLLLKKLHEFALACLASLGPETAEESKALIPSLEGWFEDEEL


Parental protein
QQILDDIQTKRSFQY
QQI.D..QTK.SFQY
Retrocopy
QQIPDN-QTKCSFQY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide