RetrogeneDB ID:
retro_mputfur_613
Organism:
Location:
GL896926.1:5018215-5018707 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.15 %
Coverage:
97.06 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
SRSF3
Parental gene aliases:
No gene alias available
Parental gene description:
serine/arginine-rich splicing factor 3 [Source:HGNC Symbol;Acc:10785]

Genomic region (view in browser)





>retro_mputfur_613
GAAATGCATCGTGATTCCTGTCCATTGGACTGTAAGGTTTATGTAGGTAATCTTGGAAAC
AACGGTAACAAGACTGAATTGGAACGAGATTTTGGCTATTATGGACCACTCCGAAGTGTG
TGGGTTGCTAGAAACCCTCCCGGCTTTGCTTTTGTTGAATTTGAAGATCCCCGAGATGCA
GCCGATACTGTCCGAGAACTAGATGGGAGAACATTATGTGGCTGCTGAGTAAGAGTGGAA
CTCTCGAATGGTGAAAAGAGAAGTCGAAATCGTGGCCCACCTCCGTCTTGGGGTTGTCGC
CCTCGAGATGATTATCGGAGAAGTCCTCCACCTCGCCGCAGATCTCCAAGACGGAGAAGC
TTCTCCCGCAGCCAGAGCAGGTCCCTTTCTAGAGATAGGAGGAGAGAGAGATCCCTGTCT
CAGGAGAGAAATCACAAGCCGTCCCGATCCTTTTCTAGGTCTCGTAGCGGATCTAGATCA
AATGAAAGGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRR
EMHRDSCPLDCKVYVGNLGNNGNKTELER.FGYYGPLRSVWVARNPPGFAFVEFEDPRDAAD.VRELDGRTLCGC.VRVELSNGEKRSRNRGPPPSWG.R
Retrocopy
EMHRDSCPLDCKVYVGNLGNNGNKTELERDFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADTVRELDGRTLCGC*VRVELSNGEKRSRNRGPPPSWGCR


Parental protein
PRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
PRDDY.RRSPPPRRRSPRRRSFSRS.SRSLSRDRRRERSLS.ERNHKPSRSFSRSRS.SRSNERK
Retrocopy
PRDDY-RRSPPPRRRSPRRRSFSRSQSRSLSRDRRRERSLSQERNHKPSRSFSRSRSGSRSNERK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide