RetrogeneDB ID:
retro_mputfur_616
Organism:
Location:
GL896926.1:11060722-11061366 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.73 %
Coverage:
75.87 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
CAPZA1
Parental gene aliases:
No gene alias available
Parental gene description:
capping protein (actin filament) muscle Z-line, alpha 1 [Source:HGNC Symbol;Acc:1488]

Genomic region (view in browser)





>retro_mputfur_616
TATGAAGAGCAGGTCTTAATTAGAGAACACAGTGTCCTAAGTAGTAACAGATTTGAGATC
CAAGAAACTAAATTTCCTTTAAGTTTGATCACTTACAGAAAGAGGCAAGTGGCCCAGAGA
ACACTGATAGAGGTCTGAAGTCTTGGAGAGAATCTTCTGACAGTACTTTAAAGGCCTGTG
TGAAAGATCATTACCTAATGGCTTCTGTACTGTTTATGCCAGAGCTATAGATGGGCAAGA
GACCATCATTGCATGTATTGAAAACCACCAGTTTTAACCAAAAAAATTTCTGGAATGGTT
GTGGGAGATCAGAGTGGAAGTTCACTGCCACACCACCTACAGCTCGGGTGGTGTGAGTAA
TTAAGATTCAGGTTCACCAATACGAAGATGGCAGTGTTCTGTTGGTTAGTTGTAAAGATG
TGCAGAATTCAATAACTGTTCCCAGTGAAGTCCAAACTGCCAAGGAGTTTATTAAAGTCA
TAGAGCATGCTGAAAATGAATATCAGTCAGCATTTAGTGAAAACTATCAAACAACGTCAT
ACCCCACATTCAAGACCTTGTGCCAGCAGCTTCCAGTTCCTCACACCAGAATTGACTGGA
ATAAGATATTCAGCTACAAGATGGCCAGAGCAATGCAGAATGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YEDQVLITEHGDLGNSRFL-DPRNKISFKFDHLRKEASDPQPEDVDGGLKSWRESCDSALRAYVKDHY-SNGFCTVYAKTIDGQQTIIACIESHQFQPK-
YE.QVLI.EH..L...RF..DPRN.ISFKFDHL.KEAS.P..E..D.GLKSWRES.DS.L.A.VKDHY..NGFCTVYA..IDGQ.TIIACIE.HQF.PK.
Retrocopy
YEEQVLIREHSVLSSNRFE/DPRN*ISFKFDHLQKEASGP--ENTDRGLKSWRESSDSTLKACVKDHY/PNGFCTVYARAIDGQETIIACIENHQF*PK\


Parental protein
NFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEVQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTR
NFWNG..RSEWKFT.TPPTA.VV.V.KIQVH.YEDG.V.LVS.KDVQ.S.TV..EVQTAKEFIK.IEHAENEYQ.A.SENYQT.S..TFK.L..QLPV..
Retrocopy
NFWNGCGRSEWKFTATPPTARVV*VIKIQVHQYEDGSVLLVSCKDVQNSITVPSEVQTAKEFIKVIEHAENEYQSAFSENYQTTSYPTFKTLCQQLPVPH


Parental protein
TKIDWNKILSYKIGKEMQNA
T.IDWNKI.SYK....MQNA
Retrocopy
TRIDWNKIFSYKMARAMQNA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide