RetrogeneDB ID:
retro_mputfur_619
Organism:
Location:
GL896927.1:302071-302545 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.99 %
Coverage:
61.02 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PSME3
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) [Source:HGNC Symbol;Acc:9570]

Genomic region (view in browser)





>retro_mputfur_619
AAGGTGCCGGCCCTGCCCGAGGGCGAGAGGCAGCTGCTGCGGAGCAACCAGCATCTGGTG
GAGCTGATTGAGCGGGTAAAGCCCGAGATCGAGCTGCTGAGAGAGAAGTGCAACACGGTG
CGGATGTGGGTGCAGCTGCTCATCCCGAAGGTGGAGGACAGCGACAACTTCGGCGTGTCC
ATCCAGGAGGACACCGTGGACCAGCTGTGGACCGTGGAGAGCACCGCAGCCTCCTACCTG
CGTCGCTTCTCCACCTACTACAACACCAGGGCCAAGCTGGTGTCCAAGATCGTGAAGTAC
CCCCAGGTGGAAGATTACCGCCGCACGGTGGCCGAGGTGGACGAGAACGAGTATCTGAGC
GTGCGCCAGATCCTGCTGCACGTTCGGAACCAGTACGCCACCTTGCACGACGTGATCCTC
AAAAACATCGAGAAGATCAAAACCCCTCGGAGCACCAACACTGACAACCTCTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KVFVMPNG---MLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKY
KV...P.G....L.SNQ.LV..IE.VKPEI.LL.EKCNTV.MWVQLLIP..ED..NFGVSIQE.TV..L.TVES.AASYL...S.YY.TRAKLVSKI.KY
Retrocopy
KVPALPEGERQLLRSNQHLVELIERVKPEIELLREKCNTVRMWVQLLIPKVEDSDNFGVSIQEDTVDQLWTVESTAASYLRRFSTYYNTRAKLVSKIVKY


Parental protein
PHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
P.VEDYRRTV.E.DE.EY.S.R.I....RNQY.TLHD.ILKNIEKIK.PRS.N...LY
Retrocopy
PQVEDYRRTVAEVDENEYLSVRQILLHVRNQYATLHDVILKNIEKIKTPRSTNTDNLY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide