RetrogeneDB ID:
retro_mputfur_621
Organism:
Location:
GL896927.1:12070765-12071309 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.37 %
Coverage:
72.62 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
PDCD2
Parental gene aliases:
No gene alias available
Parental gene description:
programmed cell death 2 [Source:HGNC Symbol;Acc:8762]

Genomic region (view in browser)





>retro_mputfur_621
TTTAGAGATCAGCTACTCAGGAAAAACGACTTTTATCCCTAGAAGCCATCTGCTGAGCAC
CCTCTGCCAGAGTCAGGGGAGTCTCTGTGCCTCCAGCTCAGGTCCGGTGCTCATTTCTGT
GGGGCTTGTGGCTGTTGAGGCCCCGAAAACCTGCTCCAGATTCCGCACGGCACGTCACTT
CAGTAAGGAGCATTAGGCTCTAGACTAGAGATTTGAGCATCAGCAGGTTTGTTCACAACC
ATATTAATGGGGCAGAACAATTCCAGACCACAACTTCCTTTACCCAGAATTTGAAACTGT
AGTAGAAACCAAAGATGAGTTTACACCTGAAGTTGTCAAAATAGAAAATGAATCAGAAAT
TATGGGGAGCATGAGTGAAAGCCCCCGACGGAGAATGGGATTCCATGGCAAAACATGAAT
CCAAAGAAGATGAATTTTCCAGAAGTTTAGAATAGCCCTTAAGCCGGAACAGTTTCTCAG
ATATGGCAAAGGGACCGCACCCATCTGGATCTCTGGTGAAAATATCCCTCAAGGAGAGGC
TATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FRNQLPRKNDFYSYEPPSEDPPAETGDRVRLQLPSGAHLCRVCGCLGP-KTCSRCHKAHYCSREHQTLDWRSGHKQACTSSDYLDRTIPDHNFLFPEFEI
FR.QL.RKNDFY...P..E.P..E.G....LQL.SGAH.C..CGC.GP.KTCSR...A...S.EH..LD.R..H.Q.C.......RTIPDHNFL.PEFE.
Retrocopy
FRDQLLRKNDFYP*KPSAEHPLPESGESLCLQLRSGAHFCGACGC*GP\KTCSRFRTARHFSKEH*ALD*RFEHQQVCSQPY*WGRTIPDHNFLYPEFET


Parental protein
VIETEDEITPEVVEKEHESEILGSMGE-ALEDELDSMAKHESKEDK-IFQKFKTKIALEPEQVLRYGRGIAPVWISGENIPQEKDI
V.ET.DE.TPEVV..E.ESEI.GSM.E.A...E.DSMAKHESKED..IFQKF...IAL.PEQ.LRYG.G.AP.WISGENIPQ...I
Retrocopy
VVETKDEFTPEVVKIENESEIMGSMSE\APDGEWDSMAKHESKEDE/IFQKF--RIALKPEQFLRYGKGTAPIWISGENIPQGEAI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide