RetrogeneDB ID:
retro_mputfur_623
Organism:
Location:
GL896927.1:14573160-14573677 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.59 %
Coverage:
96.65 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
MRPL13
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L13 [Source:HGNC Symbol;Acc:14278]

Genomic region (view in browser)





>retro_mputfur_623
AGTTTCTCTAAGGCACTCCAGCAATGGGCCACTTTTGCTCAGGCTTGATATCTCTTAGGT
GGGAAAATGCAGCCCCCTGGCAAACTGGCTGTTAGGGCATCAGATAAACTTCAAGGATTG
GATTAAACCTTTCTACCATCAACTGAGTGACTATGCGGATTGTGTGGTCATAATGGGCAC
AAGGCACATTGCATTTCCTGGAAATAAATGGGAACAGAAAGTATAGTCTACACATACTGG
CTATCCAGGTGGATTTAAATGAGTAACAGCTGCTGAACTTCATGAGAAGGATCTAGTAGC
GAATGCGAAACTAGCTATTTATGGCATGCTGCTAAAAAACCTTCACAGAACTACGATGCA
GAGATTGCATCTTTTCCCAGATGAGGACATACGAGGAGATATTCGTAAGTATTTAGTGGA
AGAGCTTCCTCACCCAAGAAAATGACCCACATGTCTAGATAAGTACACACAGGAAGAAAT
AGAGGCTTTCCCAAGAGTATGGTCTCAACCTGAAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SFSKAPQQWATFARVWYLLDGKMQPPGKLAAVASIKLQGLH-KPIYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHQKDPI
SFSKA.QQWATFA...YLL.GKMQPPGKLA..AS.KLQGL..KP.YHQLSD..D.VVIM.TRHIAF.GNKWEQKV.S.HTGYPGGFK.VTAA.LH.KD..
Retrocopy
SFSKALQQWATFAQA*YLLGGKMQPPGKLAVRASDKLQGLD\KPFYHQLSDYADCVVIMGTRHIAFPGNKWEQKV*STHTGYPGGFK*VTAAELHEKDLV


Parental protein
AIVKLAIYGMLPKNLHRRTLMQRLHLFPDEDIPEDIRKNLVEELPQPRKVPRRLDEYTQEEIEAFPRLWSPPLD
A..KLAIYGML.KNLH.RT.MQRLHLFPDEDI..DIRK.LVEELP.PRK.P..LD.YTQEEIEAFPR.WS.P.D
Retrocopy
ANAKLAIYGMLLKNLH-RTTMQRLHLFPDEDIRGDIRKYLVEELPHPRK*PTCLDKYTQEEIEAFPRVWSQPED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide