RetrogeneDB ID:
retro_mputfur_625
Organism:
Location:
GL896927.1:1208491-1209217 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.58 %
Coverage:
54.62 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
G3BP1
Parental gene aliases:
No gene alias available
Parental gene description:
GTPase activating protein (SH3 domain) binding protein 1 [Source:HGNC Symbol;Acc:30292]

Genomic region (view in browser)





>retro_mputfur_625
ATAGTTATAGAGAAACCTAGTCCCCTGTGGGTGGGGCAGGAACTTGTGAGGAAGTATTAT
ACATCGCTAAACCAGGCCCCAGACATGCCTCGCAGATTTTATGGAAAGAACTCTTCTTAT
GTCCGTGGGGGGTTGGATTCAAATGGAAAGTCAGCAGATGCAGTTTATGGACAGAAAGAA
ATTCATAAGAAAATGATGTCACAAAACTTTCCCAATTGTCACACTAAGAGGTGTAATCCT
CATGCCATCTCAGAATGATGGTGTCCAGGTAATGGGGTTGCTCTCTAATAACAACCAGCT
TTTTAGGAGATTCATGAAGACATTTGCCCTTGGTCCTAAGGGCTCTGTTGCAAATAAGTT
CTACATTCATATCTCCAGATACCAAGATGAGGTCTTTGATGGCTTTGTCACTGAGCCTCA
GGAGAAATCTGAGGAAGAGGGAGAGAAACCTGAAGAAAGACAGAAGACACCTGAGGTCGT
ACTTGATGATTCTGGAACTTTCTATGATCAGACTGTCAGCAATGACTTGGAAGAACATTT
AGAGGAACCTGTTGCTGAGCCAGAACCAGAGCAAGAACCTATCTTTGAAATCCAACAGGA
AAATCTGAGCCAGTATTAGAAGAAACTACTCCTGAGGATACGCAGAAGAGTTCTTCCCCA
ACACCTATGAACATAGATCAGACCATACAGGAAAACTTAAGGACATTTTCTTGGGAATTG
GTGACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHA-TLNDGVVVQVMGLLS
.V.EKPSPL.VG.E.VR.YYT.LNQAPDM..RFYGKNSSYV.GGLDSNGK.ADAVYGQKEIH.K.MSQNF.NCHTK......HA...NDGV..QVMGLLS
Retrocopy
IVIEKPSPLWVGQELVRKYYTSLNQAPDMPRRFYGKNSSYVRGGLDSNGKSADAVYGQKEIHKKMMSQNFPNCHTK--RCNPHA\SQNDGV--QVMGLLS


Parental protein
NNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQTVSNDLEEHLEEPVAEPEPDPEP
NNNQ..RRFM.TF.L.P.GSVANKFY.H..I.RYQDEVF.GFVTEPQ...................V.DDSGTFYDQTVSND....LEE...EP...PEP
Retrocopy
NNNQLFRRFMKTFALGPKGSVANKFYIH--ISRYQDEVFDGFVTEPQXXXXXXXXXXXXXXXXXXXVLDDSGTFYDQTVSND----LEEHLEEPVAEPEP


Parental protein
EQEQEPVSEIQEE-KSEPALEETAPEDVQKSSSPAPTDITQTVQEDLRTFSWASVT
EQE..P..EIQ.E.KSEP.LEET.PED.QKSSSP.P..I.QT.QE.LRTFSW..VT
Retrocopy
EQE--PIFEIQQE/KSEPVLEETTPEDTQKSSSPTPMNIDQTIQENLRTFSWELVT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide