RetrogeneDB ID:
retro_mputfur_630
Organism:
Location:
GL896927.1:13460677-13461381 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.27 %
Coverage:
52.16 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
MLLT3
Parental gene aliases:
No gene alias available
Parental gene description:
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3 [Source:HGNC Symbol;Acc:7136]

Genomic region (view in browser)





>retro_mputfur_630
ATTTCAGATTCCAAAGAACTCTCAGCCAAAAAAAGGAAAAAGAGTAGTTCAGATGCTTTA
TTTAAGAGTTTTTCTAGCATGCCACCATTGTTTCTCATGTGTTCTGCTGACAAAAAACAG
ATAAAAGATAAATCTCACATCAAGATGGGAAAGGTCAAAATTGAAAGTGAGACCTCTGAG
AAGAACAGACAACTTTACTGCCATTTGACAATATTGTGGATCCCAATGATTCCGACACGG
AGGAGTACATGTCCTCCAGATCTGATTCTAAACAACCCAGCCCTGCCAACTCCAGCTCCA
GCTTCACACTGTCCCAGACCAGGCAACAAGGTCCTTTAAGGTCTGTAATGAAAGATCTGC
ATTCCGATGACAATGAGGAATCAGATGAGAGAGAGGATAATGACAATGACTCTGAAATGG
AGAGACGTGTAAATAGAGGAGGGAGCCAAAGCCGCAGGGTTAGCTTAAGTGACGGCAGCG
ACAGTGAAAGCAGCTCAGCTTCTTCACCCTCCATCACAAACCTCCACCGCCTTTATTAAA
AAGCAACAACAACCAGGTTCTTGAAGTGAAAAGTCCAATAAAGCAAAGCAAATCAGATAA
GCAAATAAAGAATGGTGAATGTGACAAAGCTCTACCTACTGGTGGAGCTTCACAGAAGGT
TAATGATGCTGAGGGAGAGACACATTCTGCAACAGGTTGTGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEK-KKSTLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSS
ISDS.ELSA.....SSS.ALFKSFSS.PPL.L.CSADKKQIKDKSH.KMGKVKIESETSEK....TL.PFD.IVDPNDSD.EE.MSS.SDS.QPSPA.SS
Retrocopy
ISDSKELSAXXXXXSSSDALFKSFSSMPPLFLMCSADKKQIKDKSHIKMGKVKIESETSEK/EQTTLLPFDNIVDPNDSDTEEYMSSRSDSKQPSPANSS


Parental protein
SSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSP-LHHEPPPPLLKTNNNQILEVKSP
SS....FT.SQTRQQGPLRS.MKDLHSDDN.EESDE.EDNDNDSEMER.VNRGGS.SRRVSLSDGSDSESSSASSP.LHH.PPPPLLK.NNNQ.LEVKSP
Retrocopy
SS----FTLSQTRQQGPLRSVMKDLHSDDN-EESDEREDNDNDSEMERRVNRGGSQSRRVSLSDGSDSESSSASSP/LHHKPPPPLLKSNNNQVLEVKSP


Parental protein
IKQSKSDKQIKNGECDKA-YLDELVELHRRLMTLRERHILQQVRN
IKQSKSDKQIKNGECDKA.YL..LVELHRRLM.LRERHILQQV.N
Retrocopy
IKQSKSDKQIKNGECDKA\YL--LVELHRRLMMLRERHILQQVVN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide