RetrogeneDB ID:
retro_mputfur_631
Organism:
Location:
GL896928.1:43920-44259 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.93 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP5G2
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Source:HGNC Symbol;Acc:842]

Genomic region (view in browser)





>retro_mputfur_631
TCTGCCCCCTTCTTGGTCAGGGGCACTTCTCAGCCCTTGAACGGATTAATGTCTACAGCA
GTGCTAAAAGCACCGGAAACACTGACGGATAAGAGCCTCAGCAGCTTGGCAGCCCTGTGT
CCCCTGACTTCACTTATTCCCAGTCGCAGCTGAATCAGAGCCATTTCAAGGGACATTGGC
CCAGCTGCCAAGTGCATGGGGGCTGGGGCTGCAGTGGTAGGCGTGGCTGGCTCTGGGGCT
GGAACTGGGACTGTGTTTGGGAATTTCATCATTGGTCATGTCAGGAACCTGTCTCTGAAG
CAACAGCTCTTCCCCTGTGCCATTCTGGGCTTTGCCCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
STPFLVRSTSQLLSRSLSAVVLKPPETLTDEGLSILAAPRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSL
S.PFLVR.TSQ.L....S..VLK.PETLTD..LS.LAA..PLTSLIPSRS....AISRDI..AAK..GAGAA.VGVAGSGAG.GTVFG..IIG..RN.SL
Retrocopy
SAPFLVRGTSQPLNGLMSTAVLKAPETLTDKSLSSLAALCPLTSLIPSRS*-IRAISRDIGPAAKCMGAGAAVVGVAGSGAGTGTVFGNFIIGHVRNLSL


Parental protein
KQQLFSYAILGFAL
KQQLF..AILGFAL
Retrocopy
KQQLFPCAILGFAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide