RetrogeneDB ID:
retro_mputfur_633
Organism:
Location:
GL896928.1:13327523-13328142 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.56 %
Coverage:
66.99 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
PPP2CA
Parental gene aliases:
No gene alias available
Parental gene description:
protein phosphatase 2, catalytic subunit, alpha isozyme [Source:HGNC Symbol;Acc:9299]

Genomic region (view in browser)





>retro_mputfur_633
GACAACTAGGTGTTCCCCAAGGAGCTGCACCAAGGGGCTGAGCAGCTGAACGATGATAAA
TAGCTTAATGAGAACGATGTGCAGTGCTGTGCAGAAAGGCTAAGGAAATTTTAACAAAAG
AATCAGAAGTGCAAGAGGTTCATTGTCTCGTTCCACTGCGTGGAGATGTGCATGGTCAAT
TCCATGATCTCATGGAACTCTTTAAAATTGGTAGAAAATCACCAGGTACAAACTATCTAT
CTATGGGAGACAGTGTAGACATAAGCTATCCTAATTGGAGACTGTGACTCTCCTTGTGGT
CTTAAAGGTGTGTTACCTAGAATGCATTACAATATTGGGAGGAAACCATGAGAGTCGATG
AGTTACCCAAGTATATGGCTTTTATGATGAATGTCTGTGAAAGCATGGAAATGCCAAAGT
GTGGAAATATTTTACAGATCTATTTGATTATCCTCCACTTACGGCACTAGTAGATGGACA
GATATTCAACCTTCATGGTGGCCTCTCTCCCTTCCTAGATACACTGGATCATAGAGGAGC
CTCGAATCATTTACAAGAAGTTCCACAGGAAAGGTCCAGTGTGTGATCTGTAGTGGGCAG
ATCAGGTGATCGTGGTGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DEKVFTKELDQWIEQLNECKQLSESQVKS-LCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYS-VETVTL
D..VF.KEL.Q..EQLN..K.L.E..V...LC.KAKEILTKES.VQEV.C.V...GDVHGQFHDLMELF.IG.KSP.TNYL.MGD.VD..Y....ETVTL
Retrocopy
DN*VFPKELHQGAEQLNDDK*LNENDVQC/LCRKAKEILTKESEVQEVHCLVPLRGDVHGQFHDLMELFKIGRKSPGTNYLSMGDSVDISYPN/LETVTL


Parental protein
LVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHE-GPMCDL
LV.LKV.Y.E.ITIL.GNHESR..TQVYGFYDECL.K.GNA.VWKYFTDLFDY.PLTALVDGQIF.LHGGLSP..DTLDH..A...LQEVP.E.GP.CDL
Retrocopy
LVVLKVCYLECITILGGNHESR*VTQVYGFYDECL*KHGNAKVWKYFTDLFDYPPLTALVDGQIFNLHGGLSPFLDTLDHRGASNHLQEVPQE\GPVCDL


Parental protein
LWSD-PDDRGG
.W.D...DRGG
Retrocopy
*WAD/SGDRGG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide