RetrogeneDB ID:
retro_mputfur_634
Organism:
Location:
GL896928.1:13725042-13725535 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.42 %
Coverage:
83.42 %
Frameshifts:
5
Stop codons:
1


Parental gene:
Parental gene symbol:
NMRK1
Parental gene aliases:
No gene alias available
Parental gene description:
nicotinamide riboside kinase 1 [Source:HGNC Symbol;Acc:26057]

Genomic region (view in browser)





>retro_mputfur_634
ATGAAAACATTTGTCATTGGAGTTAGTACTGTGACAAATGGCAGGAAGACAACATGGCTA
AGAATCTGCAGAACTACCTTCCAAACTGCAGCATCATATCTCAGGATGATTTTTTTAAGC
CAGAGTATGAGAAAGAGACAAATACAGATGGATTTCTGCAGTATGATGTGCTTAAAGCAC
TCAACATGGAAAAAATGATACCCACCATTTCCTGCTGGACAAAAAGCCCAAGACACTCAC
TATTACCAACAGACTCTGTAAATGCTAAGAATTCCCATATTAATCATCAAAGGCTTCCTT
CTCTTTAACTATAAGCCCCTCGACACTCTATGGAACAGAAGCTACTTTCTGACCATTCTA
TACGAAGAATATAAAAGGAGGAGGAGTATAAAGCTCTACGAGCCTCCAGACCCCCAATGT
ACTTTGATGGCCACATGTAGTCCAGGTACATAAAGCCCAGAGAAGAAATGGAGACATAAG
GTGGGAAACTTTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKTFVIGISGVTNGGKTT-LAKKLQKHLPNCSVISQDDFFKPQSEIETDTNGFLQYDVLEALNMEKMMSAISRWMESPRHSPVSTDSGSTE-EIP-ILII
MKTFVIG.S.VTNG.KTT..AK.LQ..LPNCS.ISQDDFFKP..E.ET.T.GFLQYDVL.ALNMEKM...IS.W..SPRHS...TDS.....E.P.ILII
Retrocopy
MKTFVIGVSTVTNGRKTT/MAKNLQNYLPNCSIISQDDFFKPEYEKETNTDGFLQYDVLKALNMEKMIPTISCWTKSPRHSLLPTDSVNAK/EFP/ILII


Parental protein
EGFLLFNYKPLDALWNRSYFLTIPYEECKRRRSTRVYEPPD-VPGYFDGHVWPMYLKHRQEIE-NITWEII
.GFLLFNYKPLD.LWNRSYFLTI.YEE.KRRRS...YEPPD..P.YFDGH....Y.K.R.E.E..I.WE..
Retrocopy
KGFLLFNYKPLDTLWNRSYFLTILYEEYKRRRSIKLYEPPD/PPMYFDGHM*SRYIKPREEME/DIRWETL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide