RetrogeneDB ID:
retro_mputfur_639
Organism:
Location:
GL896930.1:1702494-1702743 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.24 %
Coverage:
62.04 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL28
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L28 [Source:HGNC Symbol;Acc:10330]

Genomic region (view in browser)





>retro_mputfur_639
CCCATGGCCAAGGGCAAAGGTGTAGTGGTAGTCATGAAGTAGAAATCTCAGTGAAAACCT
GCCACCTCCTATGTGCAGGCCACCATGAACAAGAATGCCTGGGCCACACTCAGCAGCATC
ATGCACGTAATCTGCAAGAACAAGTACTGCCCAGTTCTGCACATGGATGCCGCTCACAGA
GCCAGCACCATTCTGCACAGCCAGAAGCCTACAATGGTGAAGAAGGAGAATCGTACCACC
AAGAGCTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PAADGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSVRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRARPTKSS
P.A.GKGVVVVMK..S.Q.KPATSYV..T.NKNA.ATLSS..H.I.KNKY.P.L.M.A..RAS.IL.SQKP.MVK.K..R.TKSS
Retrocopy
PMAKGKGVVVVMK*KS-Q*KPATSYVQATMNKNAWATLSSIMHVICKNKYCPVLHMDAAHRASTILHSQKPTMVK-KENRTTKSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide