RetrogeneDB ID:
retro_mputfur_640
Organism:
Location:
GL896930.1:1736303-1736795 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.46 %
Coverage:
59.64 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
MCUR1
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial calcium uniporter regulator 1 [Source:HGNC Symbol;Acc:21097]

Genomic region (view in browser)





>retro_mputfur_640
TTGGCCAGAGGCACCCTCCACCTGTGCCACAGCCAAGTGGCTGCCCTTGCTTCCTCCGGA
AAAGAACTAAGCCTTTCTGTTGGGAGCCTGCAGCTGGAGCACAAAAGGAGAGATTTCACC
TCTTGTGGAGAAAACAAGAAGCTCTACTTTAAGACCCATACCCTAGTACATTTACTCGAA
GAAAATGGGTTCACAACCTAGTAAACAGAAATCACCATCTGTGTGTTGGTCAAGATCAGG
GACATCAGCATGGATATTGTCTACAAGGATATGGTAACCAAGATGCAGCAGGAGATGGCT
GTTCAGCAAAGAAGACCTTAGACTGCTAATGTGAAAAATGATATTATTTTGGAGAAGAGT
GAATTTTCAGCCCTCAGAGCAGAAAAAGAGAAAATAAATCTTGAACTACAACAGTTAAAA
CAAGAAATGAATGAAGTAATCAAAGTCCAAACAGATAGCAAATTAGACTTCAATCTACAC
AGGGGAAGAATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LCRGRVAALTSSRRELSLSAGSLQLE-HRRDLEHKRRDFTSCG-NKKLYFDTHALVCLLEENGFTTQQAEITVSALVKITDANMDIVYKDMVTKMQQEIT
L.RG......S....L..S...L.L......LEHKRRDFTSCG.NKKLYF.TH.LV.LLEENGFTT...EIT...LVKI.D..MDIVYKDMVTKMQQE..
Retrocopy
LARGTLHLCHSQVAALASSGKELSLSVGSLQLEHKRRDFTSCGENKKLYFKTHTLVHLLEENGFTT**TEITICVLVKIRDISMDIVYKDMVTKMQQEMA


Parental protein
VQQIMSQIANVKKDMIILEKSEFSALRAENEKINVELHRLKQQIMDEVVKVRTDTKLDFNLEKSRV
VQQ.....ANVK.D.IILEKSEFSALRAE.EKIN.EL..LKQ..M.EV.KV.TD.KLDFNL...R.
Retrocopy
VQQRRP*TANVKND-IILEKSEFSALRAEKEKINLELQQLKQE-MNEVIKVQTDSKLDFNLHRGRI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide