RetrogeneDB ID:
retro_mputfur_645
Organism:
Location:
GL896930.1:9294151-9294655 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.41 %
Coverage:
65.53 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
WBP2
Parental gene aliases:
No gene alias available
Parental gene description:
WW domain binding protein 2 [Source:HGNC Symbol;Acc:12738]

Genomic region (view in browser)





>retro_mputfur_645
GAGTTTGTGTTCAAGGACATGAAGAACATGCCAGAGGTCTTCAAAGGCACCAAGAGAGGC
ACCATCTACTATTACCTTCCCAGTTCCACTTCTCTGTCCAAAGAAAAGATGCCATCCAAT
CCTTCATGATGCCATTTTATCTGATAACGGACTGCAAAACCAAGCGACCTGTGTTGGATG
TAAACTACATCAAGAGAACAGTGAAGGTTGAAGTGGCTGGGAAAGTGACTGCTTTGTTTA
AGCAGACCTTTACACCAAGAGCCACCGCTGAGTCAGACACCAGATGCTACAGGTGAGAGC
TCCATTCTCCAAAGCTGAAGCCTCCAATGCAGCCTACAGGTACTCTCATGTGCCTCGCAG
GGCCCTTGTCTTTCCCCTGCCAGTTACCAATGGAATGTACCCCTGTCATTCTGGCTACTT
CTATCCACCACTCCATTTGACTTCTATCTAGGACCTCGTGTGATGAACATGGAATAGTTG
CAACCATGGCCACAACCTTATCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ELTFNDMKNVPEAFKGTKKGTVY-LTPYRIIFLSKGRDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGAASYKLTFTAGGAIEFGQR-M
E..F.DMKN.PE.FKGTK.GT.Y.L.P....F.....DA.QSFMMPFYL..DC..K.PV...NYIK.TVK.E..G.....A..K.TFT.....E...R.M
Retrocopy
EFVFKDMKNMPEVFKGTKRGTIY/LLPSQFHFSVQRKDAIQSFMMPFYLITDCKTKRPVLDVNYIKRTVKVEVAG--KVTALFKQTFTPRATAESDTR/M


Parental protein
LQVASQASRGEAPNGAYGYSHMPGGAYVFPPPFANGMYPCPPGYPYPP-PPPEFYPGPPMMDGAMGYVQPPPPPYP
LQV....S..EA.N.AY.YSH.P..A.VFP.P..NGMYPC..GY.YPP..P..FY.GP..M...M...QP.P.PYP
Retrocopy
LQVRAPFSKAEASNAAYRYSHVPRRALVFPLPVTNGMYPCHSGYFYPP/TPFDFYLGPRVMN--ME*LQPWPQPYP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide