RetrogeneDB ID:
retro_mputfur_647
Organism:
Location:
GL896931.1:780737-781212 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
51.57 %
Coverage:
55.63 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
TPM2
Parental gene aliases:
No gene alias available
Parental gene description:
tropomyosin 2 (beta) [Source:HGNC Symbol;Acc:12011]

Genomic region (view in browser)





>retro_mputfur_647
AGAGGTGTGGAGGTTCTCGAGAGCTGAGCCATAAAAGATGAAGAAAAGATGGAACACCAG
GAAATCCAACTCAGAGAGGCCAAGCACACTGCAGAAAAGGCCAATCGAAGTCTGAAAAGA
GGGGGCTCAGAAGTCGGTGATTATAGAGGGGGACCCGGAACGCCCAGAGGAACGAGCTGA
GCTGGCAGAGTCCCGCTGCCGGGAGGTGGATGAGCGGATCCCAGTGACAGACCAGAACCC
GAGGTGTGTGTGTGCTGCTGAGGAACAGCACTCTGAGAGGGAAGACAGCGATGGGGAAGA
GGCAAAGATTCTCATGGTTAAACTCAAGGCGGCAGAGACTGGTGCTGAGTTTGCTGAGAC
ATCGGCAGCCAAGCGGGAGAAGACGATCGAAGATTTGGAAGATAAACTGAAATGCACCAA
AGATGAGCACCTCCGCACACAAAGAACGCTGCACCAGGCTCTGCTTGGTCTGAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYE-EVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEE
RG..V.E..A.KDEEKME.QE.QL.EAKH.AE...R....E.A.K.VI.EG..ER.EERAE.AES.C....E.......N.....A.....S..ED...E
Retrocopy
RGVEVLES*AIKDEEKMEHQEIQLREAKHTAEKANRSLK\EGAQKSVIIEGDPERPEERAELAESRCREVDERIPVTDQNPRCVCAAEEQHSEREDSDGE


Parental protein
EIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLELN
E.K.L..KLK.AET.AEFAE.S.AK.EKTI.DLE..L...K.E......TL.Q.LL.LN
Retrocopy
EAKILMVKLKAAETGAEFAETSAAKREKTIEDLEDKLKCTKDEHLRTQRTLHQALLGLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide