RetrogeneDB ID:
retro_mputfur_649
Organism:
Location:
GL896931.1:8625761-8626405 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.67 %
Coverage:
83.33 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
DNALI1
Parental gene aliases:
No gene alias available
Parental gene description:
dynein, axonemal, light intermediate chain 1 [Source:HGNC Symbol;Acc:14353]

Genomic region (view in browser)





>retro_mputfur_649
ACTCTGCTCAAGTGTGACACACCCGGTGTTGGTGAGCTGGACACGGAGACATGTATCCCC
AAAACAGGGCCACTGAAAATTAGCCCCCAGCAGCCTGGACCCTTGGGTCCAGTCCCACAG
CCACCAAAGATCAAGATTTCTTCAACTTCCTGTGTTCTGGATGCTACAAAGAAGGCAGAA
GAAATCTTGAATGCCATCCTGTCTCCAAAGGAATGGGTGAAGGACACACAGTCACAGATC
CTGCAGGTGTCCAGCACTGCCAACACTGGAATGGATCATGGTGCATCCCTGCAGCAGCTG
AATCTGAATCTGCAATAGCAACAGGCCAGGGAGACTGGCATCTTCCCTGTGTGCAGAGAG
CTGTACTCACAGTATTTTGCTGAGCAGATCTCGGAGGTCACCATCAACTGTGTGGAGAGG
GGACTGCTTTTGCTGCAAGTCCAGGACTTGATCTATATGACCATCACCGCCTATCAGACC
TCACATGAGAACAGTGTGGCATTTGGCTCCAGGAAGGCTCTGTTGCCCGAACAGGGAAGT
CAGACATGGGGAGGACAATTGCAGAATTAGAAACAGGAAAGAGAGGTTTGGGGAGCCAAG
TGAAGGAGCAGAAGGTCATGTGTGAGGCCACCGAAAAGAGGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLLKYDTPVLVSRNTEKRSPKARPLKVSPQQPGPSGPVPQPPKTKLPSTSSVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQL
.LLK.DTP......TE...PK..PLK.SPQQPGP.GPVPQPPK.K..STS.V.D.TK.AEEILNAIL.P.EWV.DTQ..I.QVSST..T.MD......QL
Retrocopy
TLLKCDTPGVGELDTETCIPKTGPLKISPQQPGPLGPVPQPPKIKISSTSCVLDATKKAEEILNAILSPKEWVKDTQSQILQVSSTANTGMDHGASLQQL


Parental protein
DLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQ-GKSDMERKIAELEAEKKDLER
.L.LQ..QARETGI.PV.RELYSQ.F.E.I.EVTINC.ERGLLLL.V.D.I.MTI.AYQT..E.SVAFG.RKAL..EQ.GKSDM.R.IAELE..K..L..
Retrocopy
NLNLQ*QQARETGIFPVCRELYSQYFAEQISEVTINCVERGLLLLQVQDLIYMTITAYQTSHENSVAFGSRKALLPEQ/GKSDMGRTIAELETGKRGLGS


Parental protein
QVNEQKAKCEAIEKRE
QV.EQK..CEA.EKRE
Retrocopy
QVKEQKVMCEATEKRE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide