RetrogeneDB ID:
retro_mputfur_652
Organism:
Location:
GL896932.1:692983-693269 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.47 %
Coverage:
63.16 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
COX5A
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome c oxidase subunit Va [Source:HGNC Symbol;Acc:2267]

Genomic region (view in browser)





>retro_mputfur_652
TGCTACTCTTGTGGGTCAGAGGAAACAGATGAGGAATTTGATGCTCATTGGGTGACATAC
TTCTATAAGCCAGATATTGATACCTGGAAATTGTGAAGGGATGAACATGCTTGTTGGCTG
TGATCTGGTTTCAGAATCCAAAATCAATGTTGCTGCTTTGCTGGCATGTAGGTGGTGAAA
TGATTTTGCTAGTGTAGTTTTCATCCCAGAGATTGTTAAGAACAAAGTAGGACCTCATAA
GGAAATCTACCCCTAAGTCATTCAGGAGCTTAGATCAACTTTAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CYSHGSHETDEEFDARWVTYFNKPDIDAW-ELRKG-MNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLN
CYS.GS.ETDEEFDA.WVTYF.KPDID.W.E..KG.MN.LVG.DLV.E.KI..AAL.ACR..NDFAS.V.I.E.VK.K.GPHKEIYP.VIQELR.TLN
Retrocopy
CYSCGSEETDEEFDAHWVTYFYKPDIDTW/EIVKG/MNMLVGCDLVSESKINVAALLACRW*NDFASVVFIPEIVKNKVGPHKEIYP*VIQELRSTLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide