RetrogeneDB ID:
retro_mputfur_654
Organism:
Location:
GL896932.1:3938878-3940021 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.38 %
Coverage:
87.27 %
Frameshifts:
5
Stop codons:
5


Parental gene:
Parental gene symbol:
PSMC1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Source:HGNC Symbol;Acc:9547]

Genomic region (view in browser)





>retro_mputfur_654
CAGTGCCGGTTATAATTATTGAAGTTAGAGAGAATTAAAGACTCTCTTCTCATTGAGGAA
GAATTCATTAGAAATCAGGAACAAATGAAGACTTTAGAAGAAAAGCAAGAGGAGGAAAGA
TCTAAGGTGTACGATCTTAGGGGGACCCCAATATCAGGAGGAACTTTGGAAAAGATCATT
GATGACAATCATGCCATTGTGTTTTCATCTATAGGCTCAGAACACTACGTCAGCATTCTT
TCCTTTGTAGACAAGTATCTGTTTGAAACAGATTAGTCTGTCTTGCTCAGCCACAAGGAG
CATGCTGTCATAGGGGTGTTCATGGGTGACAGCAGATCCCTTGGTCACAGTGATGAAGGT
AGAAAAGATGACCCAGGAAACCTATGCTGATATCGGGGGGTTAGACAACCAAATCCAGGA
AATTAAGTAATCTGTGGAGCTTTCTCTCATTCACCCTGAATATTATAAAGAGATGTGTAT
AAAACCCCAAAGGAGGTCATTCTCTGTGGTCCATCTGGCACAGGTAAAACCTTATTAGCC
AAAACAGTAACAAACCAAACCTTAGCCACTTTCTTGAGAGTAACTGGCACTGAACTTATT
AAGAATTACCGAGGTGATGGGCCCAAACTTGTTTGGGAATTTTTTCAAGTTATGGAAGAA
TACGCACCATTCATTATTGATGAAATTGATGCCAATGGAACAAAAAGTTATGACTCAGAT
TCCGGTGGTGAGAGAGAAATTCAATGACCAATGCTGGAACTATTGAACCTATTGGTTGGA
TTTGATTCAAGGGGTGACATGAAAATTATCATGGCCTCAAACTGAATAGGAACTTTGGAT
CCAGCACTTATCAGACCAGGCCATATTGATGGGAAGATTGAGCTCCCCCTGCCTAATGAC
AAGACTAAGAAGTGCATCTTTCAGATCCATGCAAGCAGGATGATCTGGATGATGGTGTGA
CCCCGGACGACTTGATCATGGCTAAAGATGACCTCTGTGTGCCGATGTTGAGGCAATCTG
TCCAGAAGCTCGTCTGATGGCTTTGAGAAAATGCAGAATGAAAGTAACAAATAAAGACTT
CAAGAAATCTAAAGAAAATATTCTGTGTAAAAACCAAGAAGATACTCCTGAGGACTGTAT
CTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKV
QCRL.LLKLERIKD.LL.EEEFIRNQEQMK.LEEKQEEERSKV.DLRGTP.S.GTLE.IIDDNHAIV..S.GSEHYVSILSFVDK.L.E...SVLL.HK.
Retrocopy
QCRL*LLKLERIKDSLLIEEEFIRNQEQMKTLEEKQEEERSKVYDLRGTPISGGTLEKIIDDNHAIVFSSIGSEHYVSILSFVDKYLFETD*SVLLSHKE


Parental protein
HAVIGVLMDDT-DPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKP-PKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSE
HAVIGV.M.D..DPLVTVMKVEK..QETYADIGGLDNQIQEIK.SVEL.L.HPEYY.EM.IKP.PK.VIL.GP.GTGKTLLAK.V.NQT.ATFLRV.G.E
Retrocopy
HAVIGVFMGDS\DPLVTVMKVEKMTQETYADIGGLDNQIQEIK*SVELSLIHPEYYKEMCIKP/PKEVILCGPSGTGKTLLAKTVTNQTLATFLRVTGTE


Parental protein
LIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFP
LI..Y.GDGPKLV.E.F.V.EE.AP.I..IDEIDA.GTK.YDS.SGGEREIQ..MLELLN.L.GFDSRGD.K.IMA.N.I.TLDPALIRPG.ID.KIE.P
Retrocopy
LIKNYRGDGPKLVWEFFQVMEEYAPFI--IDEIDANGTKSYDSDSGGEREIQ*PMLELLNLLVGFDSRGDMKIIMASN*IGTLDPALIRPGHIDGKIELP


Parental protein
LPDEKTKKRIFQIHTSRM-TLADDVTLDDLIMAKDDLS-GADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE-GLYL
LP..KTKK.IFQIH.SRM..L.D.VT.DDLIMAKDDL...AD..AIC.EA.LMALR..RMKVTN.DFKKSKEN.L.K.QE.TPE.GLYL
Retrocopy
LPNDKTKKCIFQIHASRM/DLDDGVTPDDLIMAKDDLC/CADVEAICPEARLMALRKCRMKVTNKDFKKSKENILCKNQEDTPE/GLYL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide